KEGG   Homo sapiens (human): 84231Help
Entry
84231             CDS       T01001                                 

Gene name
TRAF7, CAFDADD, RFWD1, RNF119
Definition
(RefSeq) TNF receptor associated factor 7
  KO
K10646  E3 ubiquitin-protein ligase TRAF7 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Disease
H01556  Meningioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    84231 (TRAF7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     84231 (TRAF7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    84231 (TRAF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 WD40_like zf-RING_UBOX Sina zf-C3HC4 zf-C3HC4_2 zf-TRAF PKcGMP_CC zf-C3HC4_4 zf-C3HC4_3 Nup160 DUF4164 zf-RING_5 Tropomyosin_1 Filament DUF1640 DUF16 HrpB7 TPR_MLP1_2 KxDL zf-Nse
Motif
Other DBs
NCBI-GeneID: 84231
NCBI-ProteinID: NP_115647
OMIM: 606692
HGNC: 20456
Ensembl: ENSG00000131653
Vega: OTTHUMG00000128826
Pharos: Q6Q0C0(Tbio)
UniProt: Q6Q0C0 B3KQY7
Position
16p13.3
AA seq 670 aa AA seqDB search
MSSGKSARYNRFSGGPSNLPTPDVTTGTRMETTFGPAFSAVTTITKADGTSTYKQHCRTP
SSSSTLAYSPRDEEDSMPPISTPRRSDSAISVRSLHSESSMSLRSTFSLPEEEEEPEPLV
FAEQPSVKLCCQLCCSVFKDPVITTCGHTFCRRCALKSEKCPVDNVKLTVVVNNIAVAEQ
IGELFIHCRHGCRVAGSGKPPIFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCPNNPSCP
PLLRMNLEAHLKECEHIKCPHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHE
MHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASM
LNDELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTI
KVWDTCTTYKCQKTLEGHDGIVLALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIRAHDN
PVCTLVSSHNVLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAAQSYLYSGSYQT
IKIWDIRTLDCIHVLQTSGGSVYSIAVTNHHIVCGTYENLIHVWDIESKEQVRTLTGHVG
TVYALAVISTPDQTKVFSASYDRSLRVWSMDNMICTQTLLRHQGSVTALAVSRGRLFSGA
VDSTVKVWTC
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaggcaagagtgcccgctacaaccgcttctccggggggcccagcaatcttccc
accccagacgtcaccacagggaccagaatggaaacgaccttcggacccgccttttcagcc
gtcaccaccatcacaaaagctgacgggaccagcacctacaagcagcactgcaggacaccc
tcctcctccagcacccttgcctactccccgcgggacgaggaggacagcatgccccccatc
agcactccccgccgctccgactccgccatctctgtccgctccctgcactcagagtccagc
atgtctctgcgctccacattctcactgcccgaggaggaggaggagccggagccactggtg
tttgcggagcagccctcggtgaagctgtgctgtcagctctgctgcagcgtcttcaaagac
cccgtgatcaccacgtgtgggcacacgttctgtaggagatgcgccttgaagtcagagaag
tgtcccgtggacaacgtcaaactgaccgtggtggtgaacaacatcgcggtggccgagcag
atcggggagctcttcatccactgccggcacggctgccgggtagcgggcagcgggaagccc
cccatctttgaggtggacccccgagggtgccccttcaccatcaagctcagcgcccggaag
gaccacgagggcagctgtgactacaggcctgtgcggtgtcccaacaaccccagctgcccc
ccgctgctcaggatgaacctggaggcccacctcaaggagtgcgagcacatcaaatgcccc
cactccaagtacgggtgcacgttcatcgggaaccaggacacttacgagacccacctggag
acttgccgcttcgagggcctgaaggagtttctgcagcagacggatgaccgcttccacgag
atgcacgtggctctggcccagaaggaccaggagatcgccttcctgcgctccatgctggga
aagctctcggagaagatcgaccagctagagaagagcctggagctcaagtttgacgtcctg
gacgaaaaccagagcaagctcagcgaggacctcatggagttccggcgggacgcatccatg
ttaaatgacgagctgtcccacatcaacgcgcggctgaacatgggcatcctaggctcctac
gaccctcagcagatcttcaagtgcaaagggacctttgtgggccaccagggccctgtgtgg
tgtctctgcgtctactccatgggtgacctgctcttcagtggctcctctgacaagaccatc
aaggtgtgggacacatgtaccacctacaagtgtcagaagacactggagggccatgatggc
atcgtgctggctctctgcatccaggggtgcaaactctacagcggctctgcagactgcacc
atcattgtgtgggacatccagaacctgcagaaggtgaacaccatccgggcccatgacaac
ccggtgtgcacgctggtctcctcacacaacgtgctcttcagcggctccctgaaggccatc
aaggtctgggacatcgtgggcactgagctgaagttgaagaaggagctcacaggcctcaac
cactgggtgcgggccctggtggctgcccagagctacctgtacagcggctcctaccagaca
atcaagatctgggacatccgaacccttgactgcatccacgtcctgcagacgtctggtggc
agcgtctactccattgctgtgacaaatcaccacattgtctgtggcacctacgagaacctc
atccacgtgtgggacattgagtccaaggagcaggtgcggaccctcacgggccacgtgggc
accgtgtatgccctggcggtcatctcgacgccagaccagaccaaagtcttcagtgcatcc
tacgaccggtccctcagggtctggagtatggacaacatgatctgcacgcagaccctgctg
cgtcaccagggcagtgtcaccgcgctggctgtgtcccggggccgactcttctcaggggct
gtggatagcactgtgaaggtttggacttgctaa

DBGET integrated database retrieval system