KEGG   Homo sapiens (human): 84233Help
Entry
84233             CDS       T01001                                 

Gene name
TMEM126A, OPA7
Definition
(RefSeq) transmembrane protein 126A
  KO
K18157  transmembrane protein 126A
Organism
hsa  Homo sapiens (human)
Disease
H01020  Optic atrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    84233 (TMEM126A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    84233 (TMEM126A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM126
Motif
Other DBs
NCBI-GeneID: 84233
NCBI-ProteinID: NP_115649
OMIM: 612988
HGNC: 25382
Ensembl: ENSG00000171202
Vega: OTTHUMG00000166975
Pharos: Q9H061(Tbio)
UniProt: Q9H061
Position
11q14.1
AA seq 195 aa AA seqDB search
MENHKSNNKENITIVDISRKINQLPEAERNLLENGSVYVGLNAALCGLIANSLFRRILNV
TKARIAAGLPMAGIPFLTTDLTYRCFVSFPLNTGDLDCETCTITRSGLTGLVIGGLYPVF
LAIPVNGGLAARYQSALLPHKGNILSYWIRTSKPVFRKMLFPILLQTMFSAYLGSEQYKL
LIKALQLSEPGKEIH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcataaatccaataataaggaaaacataacaattgttgatatatccagaaaa
attaaccagcttccagaagcagaaaggaatctacttgaaaatggatcggtttatgttgga
ttaaatgctgctctttgtggcctcatagcaaacagtctttttcgacgcatcttgaatgtg
acaaaggctcgcatagctgctggcttaccaatggcagggataccttttcttacaacagac
ttaacttacagatgttttgtaagttttcctttgaatacaggtgatttggattgtgaaacc
tgtaccataacacggagtggactgactggtcttgttattggtggtctataccctgttttc
ttggctatacctgtaaatggtggtctagcagccaggtatcaatcagctctgttaccacac
aaagggaacatcttaagttactggattagaacttctaagcctgtctttagaaagatgtta
tttcctattttgctccagactatgttttcagcataccttgggtctgaacaatataaacta
cttataaaggcccttcagttatctgaacctggcaaagaaattcactga

DBGET integrated database retrieval system