KEGG   Homo sapiens (human): 8424
Entry
8424              CDS       T01001                                 

Gene name
BBOX1, BBH, BBOX, G-BBH, gamma-BBH
Definition
(RefSeq) gamma-butyrobetaine hydroxylase 1
  KO
K00471  gamma-butyrobetaine dioxygenase [EC:1.14.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    8424 (BBOX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.1  gamma-butyrobetaine dioxygenase
     8424 (BBOX1)
SSDB
Motif
Pfam: TauD GBBH-like_N CsiD Raf1_N
Other DBs
NCBI-GeneID: 8424
NCBI-ProteinID: NP_003977
OMIM: 603312
HGNC: 964
Ensembl: ENSG00000129151
Vega: OTTHUMG00000166121
Pharos: O75936(Tchem)
UniProt: O75936
Structure
PDB: 

Position
11p14.2
AA seq 387 aa
MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDV
NIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSEL
QLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHT
WQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQK
LKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIF
DVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISR
HLEGAYADWDVVMSRLRILRQRVENGN
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggcttgtaccatccaaaaggcagaagcacttgacggggctcatttgatgcagatcctc
tggtatgatgaggaagagtctctctacccagctgtatggttgagagacaactgtccgtgc
tctgattgctacctggattctgcaaaagcacggaaacttctagtggaagctcttgatgtg
aacattggaattaaaggcttgatatttgacagaaaaaaggtgtacatcacatggcccgat
gagcattacagtgaattccaggctgattggctgaagaaaagatgcttttccaagcaggcc
agagcaaagctccaaagagaattgttttttccagaatgccaatactggggctcagagctc
cagctacccactttggattttgaagatgttttaagatatgatgaacacgcatacaagtgg
ctctccaccctcaagaaagtaggcatagtaagactcaccggagcatctgacaaaccagga
gaagtttcaaaacttgggaaaaggatgggtttcctctatctcacattttatggacatact
tggcaagtgcaagacaaaatcgatgcaaacaatgtggcttacacaactgggaagctaagc
tttcacactgattatccagccctccatcatccacctggggttcagcttcttcactgcata
aagcaaacagtcacagggggtgattcagaaattgtagatgggtttaatgtgtgccaaaaa
ctaaagaaaaataatcctcaggcattccagattttgtcctctacctttgtggactttaca
gacattggagtggattactgtgatttttctgtacaatcaaaacataaaattatagagtta
gatgataaaggccaagtggttcgcatcaacttcaataacgcaactagggacacaatattt
gatgtgcctgttgaaagagttcagcctttttatgctgctctgaaggagtttgttgacctc
atgaacagcaaagaatccaagtttaccttcaagatgaatccaggtgatgtgattactttt
gataactggcgcttacttcatggccgacgtagctatgaagcaggaactgagatatcccgc
catctagaaggagcttatgctgactgggatgtggtcatgtcaaggcttcgtatcttaagg
cagagggtggagaatggaaactga

DBGET integrated database retrieval system