KEGG   Homo sapiens (human): 84249
Entry
84249             CDS       T01001                                 
Symbol
PSD2, EFA6C
Name
(RefSeq) pleckstrin and Sec7 domain containing 2
  KO
K12494  PH and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84249 (PSD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84249 (PSD2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    84249 (PSD2)
SSDB
Motif
Pfam: Sec7 PH_9 PH Borrelia_orfA PH_11 TEX13B_C
Other DBs
NCBI-GeneID: 84249
NCBI-ProteinID: NP_115665
OMIM: 620656
HGNC: 19092
Ensembl: ENSG00000146005
UniProt: Q9BQI7
Position
5:139742475..139844466
AA seq 771 aa
MEEDKLLSAVPEEGDATRDPGPEPEEEPGVRNGMASEGLNSSLCSPGHERRGTPADTEEP
TKDPDVAFHGLSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLYPDAED
PQLGLDGPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPL
TPLIQQRARDSPEPGAGLGIGDMAFEGDMGAAGGDGELGSPLRRSISSSRSENVLSRLSL
MAMPNGFHEDGPQGPGGDEDDDEEDTDKLLNSASDPSLKDGLSDSDSELSSSEGLEPGSA
DPLANGCQGVSEAAHRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLT
LDGALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDL
HGHNIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSEL
VDDKFGTGTKKVTRILDGGNPFLDVPQALSATTYKHGVLTRKTHADMDGKRTPRGRRGWK
KFYAVLKGTILYLQKDEYRPDKALSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTADW
RVFLFQAPSKEEMLSWILRINLVAAIFSAPAFPAAVSSMKKFCRPLLPSCTTRLCQEEQL
RSHENKLRQLTAELAEHRCHPVERGIKSKEAEEYRLKEHYLTFEKSRYETYIHLLAMKIK
VGSDDLERIEARLATLEGDDPSLRKTHSSPALSQGHVTGSKTTKDATGPDT
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggaggaggacaagctcttatctgcagtgcctgaggaaggcgatgccacccgtgacccc
ggtccagagcctgaagaggagccaggggtccggaatgggatggccagtgagggcctgaac
agcagcctctgcagcccagggcacgagcgaaggggcaccccagcggacactgaggaaccc
acgaaggacccagatgtggccttccatggcctcagccttggcctctctctcaccaatggc
ctagccctggggccagacttgaacattctggaagattcagcggagtccaggccctggagg
gctggcgtgctggcagagggggacaatgcttccaggagcctctacccagatgctgaggac
cctcagctggggttggatggtcccggggagccagatgtgcgggatggcttcagcgccacg
tttgagaagattctggagtcagagctgctgcggggcacccagtacagcagcctcgactcc
ctagacgggctgagcctcacggatgagagcgacagctgcgtcagcttcgaggcccccctc
acacccctcatccagcagcgggcccgtgacagccctgagccaggggctgggttgggcatt
ggggacatggcgtttgagggggacatgggggcagctggtggtgatggggagctgggcagc
cccctgcggcgctccatctccagcagccgctctgagaatgtcctgagccgcctgtctctc
atggccatgcccaatggattccatgaagatggccctcagggcccagggggggatgaggat
gatgatgaggaggacacggacaagttgctgaactcagccagtgaccccagcctgaaggat
ggcctgtcagactcagactctgagctcagcagctcggaggggttggagcctggtagtgca
gaccctctggccaacgggtgccagggggtcagtgaagctgctcatcggctggcacgccgt
ctctaccacctcgagggcttccagcgctgtgatgtggcccggcagctgggcaagaacaac
gagtttagcaggctggtggccggggagtacctcagtttcttcgacttctcgggcttgact
ctggacggagcactcagaacattcttgaaggccttcccgctgatgggggagacacaagag
cgtgagcgggtcctcacacacttctcccgccggtactgccagtgcaaccctgatgacagc
acttcggaagatgggatccacacgctcacctgtgccctgatgctgctcaacacggacctg
cacggccacaacattggcaaaaagatgtcctgtcagcaattcattgccaacttggaccag
ctgaatgatggccaagactttgccaaagacctgctgaagaccctttacaactccatcaag
aatgaaaagctggaatgggccattgatgaggatgagctgaggaaatccctgtctgagctg
gtggatgacaagttcgggacaggcacgaagaaggtgacgcgaatcctggatggtggcaac
cccttcctggatgtcccacaggcgctcagtgccaccacctacaagcacggcgtcctgacc
cggaagactcacgctgacatggatggcaagaggacgccccgtgggaggcgtggctggaag
aaattctacgcagtgctcaaagggaccatcctgtacctgcagaaggatgagtacaggcct
gacaaagctctatcggagggtgacctgaagaacgccattcgcgtgcatcacgctctggcc
accagggcctctgactacagcaagaagtccaacgtgctgaagcttaagacagccgactgg
agggtattcctcttccaggcaccgagcaaggaagaaatgctgtcctggatcctcaggatc
aacctggtggcagccatcttctctgccccggccttcccagccgctgtcagctccatgaag
aagttctgtcggcccctgctgccctcctgcaccacccgcctctgccaggaggagcaactg
cggtctcatgagaataagttgaggcagctgactgcggagctggccgaacacaggtgtcac
ccagtcgagaggggcatcaagtccaaggaggccgaggagtaccggttgaaggagcactat
ctcaccttcgagaaaagccgttatgagacctatatccacctcctggctatgaaaatcaaa
gtgggctcagatgatctggagcggattgaggcccggctggccactctggaaggggatgac
ccttctctccggaagacacattcaagccctgccctcagccagggccatgtgactggcagc
aaaaccacaaaggatgccactgggcctgatacttag

DBGET integrated database retrieval system