KEGG   Homo sapiens (human): 84250Help
Entry
84250             CDS       T01001                                 

Gene name
SLF1, ANKRD32, BRCTD1, BRCTx
Definition
(RefSeq) SMC5-SMC6 complex localization factor 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_3 Ank_4 Ank RTT107_BRCT_5
Motif
Other DBs
NCBI-GeneID: 84250
NCBI-ProteinID: NP_115666
OMIM: 618467
HGNC: 25408
Ensembl: ENSG00000133302
Vega: OTTHUMG00000121133
Pharos: Q9BQI6(Tbio)
UniProt: Q9BQI6 I6L9F1
Position
5q15
AA seq 1058 aa AA seqDB search
MEDGTPKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA
CAAGKWILTKDYIIHSAKSGRWLDETTYEWGYKIEKDSRYSPQMQSAPKRWREELKRTGA
PGAFHRWKVVLLVRTDKRSDSLIRVLEAGKANVILPKSSPSGITHVIASNARIKAEKEKD
NFKAPFYPIQYLGDFLLEKEIQNDEDSQTNSVWTEHSNEETNKDFRKDAGFLEMKGALRE
TMYRTQKEMQNHEDVNVGSILIQHHKKEKFSGSSKDLKFVKMRNTFGSHTYENQKEIKKK
DEDIQRSYTLRRKRKKGKESNCKKGVEHEKIKSTLRRHIYNRDQKEMKNSIFAEYAKESK
AMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAEFPRGVLNLIESL
IEGHFFKEAIEELSTLQAHYIPPVCVLHALLENVLQDNIDTFSGRYFHILSALLHLHPPW
KSPAMSRYYLELFQCPTCMKGAWSLVEVLIRSCLFNESFCHQISENIGSKVLHLTLLKFF
FNLIESEVQHLSQKLYDWSDSQNLKITGKAMLLEIFWSGSETSGLLTKPVNMLLEWTIYS
HKEKFKSNDVFKHELAYLLAGILGAAIDYWIFLGLKMGRNVMRHMSDDLGSYVSLSCDDF
SSQELEIFICSFSSSWLQMFVAEAVFKKLCLQSSGSVSSEPLSLQKMVYSYLPALGKTGV
LGSGKIQVSKKIGQRPCFDSQRTLLMLNGTKQKQVEGLPELLDLNLAKCSSSLKKLKKKS
EGELSCSKENCPSVVKKMNFHKTNLKGETALHRACINNQVEKLILLLSLPGIDINVKDNA
GWTPLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGP
VLLQQRNAKGELPLDYVVSPQIKEELFAITKIEDTVENFHAQAEKHFHYQQLEFGSFLLS
RMLLNFCSIFDLSSEFILASKGLTHLNELLMACKSHKETTSVHTDWLLDLYAGNIKTLQK
LPHILKELPENLKVCPGVHTEALMITLEMMCRSVMEFS
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atggaagatggtaccccaaagcatatcatccagatgacaggatttaagatggaagaaaaa
gaagcgctagtcaaattacttttaaaactagattgcacttttattaagagtgagaaatac
aaaaattgtacacatcttatagctgaacgcctatgtaagagtgaaaaatttttagcagct
tgtgcggcaggaaagtggatactaaccaaggactatataattcatagtgccaaaagtggc
agatggcttgatgaaacaacttatgaatggggatataaaattgaaaaagattcccgttat
tcacctcaaatgcaatctgcacctaaaagatggcgtgaagaactgaaacgcactggtgct
ccaggagccttccacagatggaaagttgtcctccttgttagaactgataagcgaagtgat
tctcttataagagttttggaggctggaaaggcaaatgttattttaccaaaaagttcacca
agtggaataactcatgtgattgccagtaatgcaagaattaaagctgagaaagaaaaagat
aactttaaggctccattttatccaattcagtatctaggggattttcttttagagaaagaa
attcagaatgatgaagattcccaaaccaattctgtttggactgaacatagcaatgaagaa
acaaacaaagatttcaggaaagatgcaggatttcttgaaatgaaaggtgccttaagagag
accatgtatagaacccagaaagaaatgcaaaatcatgaagatgttaatgttggttctatt
ttgattcaacatcacaaaaaagaaaaattcagtggttccagtaaagatttgaaatttgtt
aaaatgagaaatacctttggaagccatacatatgaaaatcagaaggaaattaagaaaaaa
gatgaagatattcagaggagttatactttgaggagaaaacgcaagaaaggaaaagaaagc
aattgcaagaaaggcgttgaacatgaaaaaataaaaagtaccttaagaaggcacatatat
aatagagatcagaaagaaatgaagaattctatttttgctgaatatgccaaagaatcaaaa
gccatggctattaagacagatgtggatgttgttgaaataaaaaataccttaaggaagcac
atatatagagctcaggctgtcagatacaactgcattagaatagataaacaaccagtgtac
aacgtagaggttaaaaatgctgaatttcccagaggtgtattaaatttaattgaaagcctc
atagaaggacatttttttaaagaagcaattgaggaactttccactttgcaggcacattat
atccctcctgtatgcgttcttcatgcccttctagagaacgttctacaggataacatagat
acattttctggtcgatactttcatatattgtcagctcttcttcacctgcatcctccttgg
aagtctccagccatgtcgagatattatttagagttgtttcagtgtccaacttgtatgaaa
ggagcatggtctttagtagaagtccttatcaggtcttgccttttcaatgaaagcttttgt
catcaaatttcagaaaatattggctccaaggtgctccacctgacgctactcaaatttttc
tttaatttaattgaaagtgaagtacaacatctgagtcaaaagttgtatgactggtcagat
tctcagaatctgaaaataacaggaaaggcaatgcttcttgaaattttttggtcaggaagt
gaaacctctgggcttttgaccaaaccagtaaatatgcttttggaatggactatatattct
cacaaggaaaaattcaagtctaatgatgtcttcaaacatgaactagcttacttattggct
ggaattcttggagcagcaatagattattggattttccttggtcttaagatgggtagaaat
gtgatgcgacacatgtctgatgacttaggaagttatgtttctctttcgtgtgatgacttt
tcttcacaggaattagagattttcatttgctccttttcctcctcctggcttcaaatgttt
gttgcagaggcagtctttaaaaagttgtgtctacagagctctggcagtgtttcttctgag
ccactctctcttcagaaaatggtatattcctatttaccagccttggggaaaactggtgtg
cttgggtctggaaagattcaggtgtcaaagaaaataggacagcggccttgttttgactct
cagagaaccttactaatgctgaatggtactaaacaaaaacaagtcgaagggctgccagag
ttactagacctgaaccttgctaaatgttcctcatcattaaaaaaattgaaaaagaagtca
gaaggagaattgtcatgttccaaggagaattgcccctctgtagttaaaaagatgaatttt
cacaagactaatctaaaaggagaaacagccctgcatagagcttgcataaataaccaagtg
gagaaattgattcttcttctctctttgccaggaatagacatcaatgttaaagacaatgct
ggctggacgcctttgcatgaagcctgtaactatggcaacacagtgtgtgtccaggaaatt
ttgcaacgttgtccagaggtagatctgctcactcaagtggacggggtgactcctttgcat
gatgcactgtcaaacggacatgtagaaattggcaagctgctactacagcatgggggccca
gtgcttttacaacagaggaatgctaagggagaattgcccttggattatgtggtttcacct
caaatcaaagaagaactgtttgctattacaaaaatagaagatacagtggagaactttcat
gcacaagcagagaaacattttcattaccagcaacttgaatttggctcctttttacttagt
aggatgttgctaaatttttgttcaatttttgatttatcttcagagttcattttagcttcc
aaagggttaactcatctaaatgaactgcttatggcttgtaaaagtcataaagaaaccacc
agtgttcatactgactggttactggatctttatgctggaaatataaagacattgcagaaa
ctcccacacattcttaaggaactgcctgagaatttgaaagtgtgtcctggggtacacact
gaggccttgatgataacattggaaatgatgtgtcggtcagtcatggagttttcatga

DBGET integrated database retrieval system