KEGG   Homo sapiens (human): 84254Help
Entry
84254             CDS       T01001                                 

Gene name
CAMKK1, CAMKKA
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    84254 (CAMKK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    84254 (CAMKK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     84254 (CAMKK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  CAMKK family
   84254 (CAMKK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 84254
NCBI-ProteinID: NP_115670
OMIM: 611411
HGNC: 1469
Ensembl: ENSG00000004660
Vega: OTTHUMG00000090725
Pharos: Q8N5S9(Tchem)
UniProt: Q8N5S9
Structure
PDB: 

Position
17p13.2
AA seq 505 aa AA seqDB search
MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSR
LLPARPSLSARKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAE
DCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
AAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVME
VPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQF
EGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILA
LHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSE
EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNL
LVKEGFGEGGKSPELPGVQEDEAAS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggaggggggtccagctgtctgctgccaggatcctcgggcagagctggtagaacgggtg
gcagccatcgatgtgactcacttggaggaggcagatggtggcccagagcctactagaaac
ggtgtggaccccccaccacgggccagagctgcctctgtgatccctggcagtacttcaaga
ctgctcccagcccggcctagcctctcagccaggaagctttccctacaggagcggccagca
ggaagctatctggaggcgcaggctgggccttatgccacggggcctgccagccacatctcc
ccccgggcctggcggaggcccaccatcgagtcccaccacgtggccatctcagatgcagag
gactgcgtgcagctgaaccagtacaagctgcagagtgagattggcaagggtgcctacggt
gtggtgaggctggcctacaacgaaagtgaagacagacactatgcaatgaaagtcctttcc
aaaaagaagttactgaagcagtatggctttccacgtcgccctcccccgagagggtcccag
gctgcccagggaggaccagccaagcagctgctgcccctggagcgggtgtaccaggagatt
gccatcctgaagaagctggaccacgtgaatgtggtcaaactgatcgaggtcctggatgac
ccagctgaggacaacctctatttggtgtttgacctcctgagaaaggggcccgtcatggaa
gtgccctgtgacaagcccttctcggaggagcaagctcgcctctacctgcgggacgtcatc
ctgggcctcgagtacttgcactgccagaagatcgtccacagggacatcaagccatccaac
ctgctcctgggggatgatgggcacgtgaagatcgccgactttggcgtcagcaaccagttt
gaggggaacgacgctcagctgtccagcacggcgggaaccccagcattcatggcccccgag
gccatttctgattccggccagagcttcagtgggaaggccttggatgtatgggccactggc
gtcacgttgtactgctttgtctatgggaagtgcccattcatcgacgatttcatcctggcc
ctccacaggaagatcaagaatgagcccgtggtgtttcctgaggagccagaaatcagcgag
gagctcaaggacctgatcctgaagatgttagacaagaatcccgagacgagaattggggtg
ccagacatcaagttgcacccttgggtgaccaagaacggggaggagccccttccttcggag
gaggagcactgcagcgtggtggaggtgacagaggaggaggttaagaactcagtcaggctc
atccccagctggaccacggtgatcctggtgaagtccatgctgaggaagcgttcctttggg
aacccgtttgagccccaagcacggagggaagagcgatccatgtctgctccaggaaaccta
ctggtgaaagaagggtttggtgaagggggcaagagcccagagctccccggcgtccaggaa
gacgaggctgcatcctga

DBGET integrated database retrieval system