KEGG   Homo sapiens (human): 84256Help
Entry
84256             CDS       T01001                                 

Gene name
FLYWCH1
Definition
(RefSeq) FLYWCH-type zinc finger 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FLYWCH FLYWCH_N FLYWCH_u
Motif
Other DBs
NCBI-GeneID: 84256
NCBI-ProteinID: NP_001294997
HGNC: 25404
Ensembl: ENSG00000059122
Vega: OTTHUMG00000177364
Pharos: Q4VC44(Tdark)
UniProt: Q4VC44
Structure
PDB: 

Position
16p13.3
AA seq 716 aa AA seqDB search
MPLPEPSEQEGESVKAGQEPSPKPGTDVIPAAPRKPREFSKLVLLTASDQDEDGVGSKPQ
EVHCVLSLEMAGPATLASTLQILPVEEQGGVVQPALEMPEQKCSKLDAAAPQSLEFLRTP
FGGRLLVLESFLYKQEKAVGDKVYWKCRQHAELGCRGRAITRGLRATVMRGHCHAPDEQG
LEARRQREKLPSLALPEGLGEPQGPEGPGGRVEEPLEGVGPWQCPEEPEPTPGLVLSKPA
LEEEEAPRALSLLSLPPKKRSILGLGQARPLEFLRTCYGGSFLVHESFLYKREKAVGDKV
YWTCRDHALHGCRSRAITQGQRVTVMRGHCHQPDMEGLEARRQQEKAVETLQAGQDGPGS
QVDTLLRGVDSLLYRRGPGPLTLTRPRPRKRAKVEDQELPTQPEAPDEHQDMDADPGGPE
FLKTPLGGSFLVYESFLYRREKAAGEKVYWTCRDQARMGCRSRAITQGRRVTVMRGHCHP
PDLGGLEALRQREKRPNTAQRGSPGGPEFLKTPLGGSFLVYESFLYRREKAAGEKVYWTC
RDQARMGCRSRAITQGRRVMVMRRHCHPPDLGGLEALRQREHFPNLAQWDSPDPLRPLEF
LRTSLGGRFLVHESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGHRIMVMRSHCHQP
DLAGLEALRQRERLPTTAQQEDPEKIQVQLCFKTCSPESQQIYGDIKDVRLDGESQ
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcccgagcccagcgagcaggagggcgagagtgtgaaggccggccaggagcca
tcccccaagccaggcacggacgtcatcccggcagcccccaggaagcccagggagttctcc
aaactggtgctgctcacagcctccgaccaagatgaggatggggtgggatccaagccccag
gaagtgcactgcgtcctgtccctggagatggctggccccgccaccctcgccagcaccttg
cagatcctgccagttgaggagcagggaggggtggtccagccagccctagagatgcctgaa
cagaagtgcagcaagctggatgcagcagcccctcagtccctggagttcctgaggacacca
ttcgggggccgcctcctggtgctggagtccttcctgtacaagcaggagaaggcagtgggg
gacaaggtgtactggaagtgccgccaacatgctgagctgggctgccggggccgggccatc
acccgaggcctgcgggccacagtgatgcggggccactgccacgcgcccgatgagcaaggc
ctggaggcccggcgccagagggagaaactgcccagcctggccctgccagagggcttggga
gagccccagggtcctgagggccctggaggccgagtggaggagcccctggagggggtgggc
ccgtggcagtgccctgaggagcccgagcccactcctgggctggtgctgagcaagccggcc
ctggaggaggaggaggcaccccgagccctgtcactgctgagcctgccgcccaagaagcgc
tcgatcctggggctgggacaggcccggcccctcgagttcctgaggacgtgctacgggggc
agcttcctggtacacgagtcgttcctctacaagcgggagaaggctgtcggggacaaggtg
tattggacctgccgggaccacgcgctgcacggctgccggagccgggccatcacccaggga
cagcgggtgactgtgatgcgtgggcactgccaccagcccgatatggagggcctggaagcc
cggcggcagcaggagaaggccgtggagacgctgcaggctgggcaggacggccctgggagc
caagtggacacgctgctccgaggcgtggatagtttgctctaccgcaggggtccgggtccc
ctgactctcaccaggcctcggcccagaaagcgagcaaaggtcgaagaccaggagctgcca
acccagcccgaggccccagacgagcaccaggacatggacgcagacccgggaggccctgag
ttcctgaagacgcccctggggggcagcttcctggtgtacgagtccttcctctaccggcgg
gagaaggcggctggggagaaggtgtattggacctgccgggaccaggcccgcatgggctgc
cgcagccgcgccatcacccagggccgacgggtgactgtcatgcgtggtcactgccacccg
cccgacctgggaggcctggaggccctgaggcagcgggagaaacgccccaacacggcgcag
cgggggagcccaggaggccccgagttcctgaagacgcccctggggggcagcttcctggtg
tacgagtccttcctctaccggcgggagaaggcggccggggagaaggtgtattggacctgc
cgggaccaggcccgcatgggctgccgcagccgcgccatcacccagggccggcgggtcatg
gtcatgcgcaggcactgccacccaccggacctgggcggcctggaggccctgcggcagcgg
gagcacttccccaacctggcgcagtgggacagcccagatcctctccggcccctggagttc
ctgaggacttccctggggggcaggttcctggtgcacgagtccttcctctacaggaaggag
aaggcggctggggagaaggtgtactggatgtgccgggaccaggctcggctgggctgccgc
agccgcgccataacccagggccaccgcatcatggtcatgcgcagccactgccatcagcct
gacctggcaggcctggaggccttgaggcaacgggagcggctccccaccacggcccagcag
gaggacccagaaaagattcaagttcagctgtgcttcaagacgtgttctcctgaaagccag
cagatttatggggacatcaaagacgtcagactggatggcgagtcccagtga

DBGET integrated database retrieval system