KEGG   Homo sapiens (human): 84267Help
Entry
84267             CDS       T01001                                 

Gene name
C9orf64
Definition
(RefSeq) chromosome 9 open reading frame 64
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Q_salvage
Motif
Other DBs
NCBI-GeneID: 84267
NCBI-ProteinID: NP_115683
OMIM: 611342
HGNC: 28144
Ensembl: ENSG00000165118
Vega: OTTHUMG00000020111
Pharos: Q5T6V5(Tdark)
UniProt: Q5T6V5
Position
9q21.32
AA seq 341 aa AA seqDB search
MDGLLNPRESSKFIAENSRDVFIDSGGVRRVAELLLAKAAGPELRVEGWKALHELNPRAA
DEAAVNWVFVTDTLNFSFWSEQDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSAS
YYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGKILLEKFGGSFLNCVRESENSAQK
LMHLVVESFPSYRDVTLFEGKRVSFYKRAQILVADTWSVLEGKGDGCFKDISSITMFADY
RLPQVLAHLGALKYSDDLLKKLLKGEMLSYGDRQEVEIRGCSLWCVELIRDCLLELIEQK
GEKPNGEINSILLDYYLWDYAHDHREDMKGIPFHRIRCIYY
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacgggctcctaaatcccagggaatcctctaaattcattgcagaaaacagtcgggat
gtgtttattgacagcggaggcgtacggagggtggcagagctgctgctggccaaggcggcg
gggccagagctgcgcgtggaggggtggaaagcccttcatgagctgaaccccagggcggcc
gacgaggccgcggtcaactgggtgttcgtgacagacacgctcaacttctccttttggtcg
gagcaggacgagcacaagtgtgtggtgaggtacagagggaaaacatacagtgggtactgg
tccctgtgcgccgccgtcaacagagccctcgacgaagggataccaataactagtgcctcg
tactacgcgacagtgaccctggatcaggttcggaatatacttcgttctgacacagacgtt
tccatgcctttagtagaagagaggcatcggattctcaatgaaaccgggaaaattctgctg
gagaagtttggaggctcttttctcaactgcgtccgagaaagtgagaatagtgcgcagaag
ttaatgcacctggtggttgaaagttttccttcttacagagatgtgactctgtttgagggg
aaaagagtttctttttacaaacgagcccaaatccttgtagcagatacgtggagtgtattg
gaaggaaaaggagatggctgcttcaaggacatctccagtatcaccatgtttgctgattat
agattacctcaggttcttgctcatcttggagccctgaaatactctgatgacctactgaag
aagcttctcaaaggagaaatgctctcatatggagacaggcaagaggtggaaatcagaggg
tgctcgctttggtgtgttgagctgatccgggattgtcttctggagcttattgaacaaaag
ggtgaaaaacctaatggagagatcaattccattcttctggattattacttatgggactat
gcccatgaccatagggaagatatgaaaggaattccgtttcatcgcatacgttgcatatat
tattga

DBGET integrated database retrieval system