KEGG   Homo sapiens (human): 84268Help
Entry
84268             CDS       T01001                                 

Gene name
RPAIN, HRIP, RIP
Definition
(RefSeq) RPA interacting protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_interact_C RPA_interact_N RPA_interact_M Snurportin1 Glyco_hydro_67C
Motif
Other DBs
NCBI-GeneID: 84268
NCBI-ProteinID: NP_001028174
OMIM: 617299
HGNC: 28641
Ensembl: ENSG00000129197
Vega: OTTHUMG00000177872
Pharos: Q86UA6(Tbio)
UniProt: Q86UA6
Position
17p13.2
AA seq 219 aa AA seqDB search
MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFL
VQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDE
KCLSIMLAEWEANPLICPVCTKYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSI
NEHSAHCPHTPEFSVTGGTEEKSSLLMSCLACDTWAVIL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcgttgaggtctccgcgccgctccctgtacaaactggtgggctcgccgcct
tggaaagaggctttccggcagagatgcctggagagaatgagaaacagccgggacaggctc
ctaaacaggtaccgccaggctggaagcagtgggccagggaattctcagaacagctttcta
gttcaagaggtgatggaagaagagtggaatgctttgcagtcagtggagaattgtccagaa
gacttggctcagctggaggagctgatagacatggctgtgctggaggaaattcaacaggag
ctgatcaaccaagagcagtccatcatcagcgagtatgagaagagcttgcagtttgatgaa
aagtgtctcagcatcatgctggctgagtgggaggcaaacccactcatctgtcctgtatgt
acaaagtacaacctgagaatcacaagcggtgtggtggtgtgtcagtgtggcctgtccatc
ccatctcattcttctgagttgacagagcagaagcttcgtgcctgtttagagggtagtata
aatgagcacagtgcacattgtccccacacacctgaattttcagtcactggaggaacagaa
gaaaagtccagtcttctcatgagctgtctggcctgtgatacttgggctgtgatcctctag

DBGET integrated database retrieval system