KEGG   Homo sapiens (human): 84269
Entry
84269             CDS       T01001                                 

Gene name
CHCHD5, C2orf9, CHTM1, MIC14, MIX14
Definition
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CX9C CHCH Pet191_N NDUF_B7 Cmc1 PID UCR_hinge Ndufs5
Other DBs
NCBI-GeneID: 84269
NCBI-ProteinID: NP_115685
OMIM: 616978
HGNC: 17840
Ensembl: ENSG00000125611
Vega: OTTHUMG00000131312
Pharos: Q9BSY4(Tbio)
UniProt: Q9BSY4 A0A2U9EWT9
Structure
PDB: 
2LQL

Position
2q14.1
AA seq 110 aa
MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQ
PFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS
NT seq 333 nt   +upstreamnt  +downstreamnt
atgcaggcggccctagaggtcaccgctcgctactgtggccgggagctggagcagtatggc
cagtgtgtggcggccaagccggaatcctggcagcgggactgtcactaccttaagatgagc
attgcccagtgcacatcctcccacccaatcatccgccagatccgccaggcctgtgctcag
ccttttgaggccttcgaggagtgtcttcgacagaacgaggcagctgtgggcaactgtgca
gagcatatgcgccgcttcctgcagtgcgctgagcaggtgcagccgccacgctcacctgca
actgtggaggcacagccacttcctgcctcctga

DBGET integrated database retrieval system