KEGG   Homo sapiens (human): 84271Help
Entry
84271             CDS       T01001                                 

Gene name
POLDIP3, PDIP3, PDIP46, SKAR
Definition
(RefSeq) DNA polymerase delta interacting protein 3
  KO
K22414  polymerase delta-interacting protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    84271 (POLDIP3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     84271 (POLDIP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1
Motif
Other DBs
NCBI-GeneID: 84271
NCBI-ProteinID: NP_115687
OMIM: 611520
HGNC: 23782
Ensembl: ENSG00000100227
Vega: OTTHUMG00000150887
Pharos: Q9BY77(Tbio)
UniProt: Q9BY77
Position
22q13.2
AA seq 421 aa AA seqDB search
MADISLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKI
GLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAREMLNSRKQQTTVPQKPRQVADAREK
ISLKRSSPAAFINPPIGTVTPALKLTKTIQVPQQKAMAPLHPHPAGMRINVVNNHQAKQN
LYDLDEDDDGIASVPTKQMKFAASGGFLHHMAGLSSSKLSMSKALPLTKVVQNDAYTAPA
LPSSIRTKALTNMSRTLVNKEEPPKELPAAEPVLSPLEGTKMTVNNLHPRVTEEDIVELF
CVCGALKRARLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQP
ILLRLSDSPSMKKESELPRRVNSASSSNPPAEVDPDTILKALFKSSGASVTTQPTEFKIK
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatctccctggacgaactcatcaggaagcgcggggcggcggcgaaaggacgg
cttaatgccagaccgggagttggaggtgtccgatctcgagttgggatccagcaaggcctt
ctcagccagtcaacacgcacagccaccttccagcagagatttgatgcccggcagaagatt
ggcctctcagatgcccggctcaaactgggagtcaaggatgcccgggagaagcttttgcag
aaagatgcccgatttcgaatcaaagggaaagtgcaggatgccagagagatgttgaactct
cgcaagcagcagaccacggtgccccagaagccccgccaggttgctgatgcccgggagaag
atcagcttgaagaggagttcccctgctgccttcataaacccacccattgggacagtgacc
cctgctctgaagctcaccaaaaccatccaggttccacagcagaaagccatggcaccactt
catccccatcctgccggaatgagaatcaatgttgtcaataaccaccaggccaaacagaat
ttatatgacctggatgaagatgatgatggtatagcttccgttcctactaaacagatgaag
tttgcagcctcaggcggctttctccaccacatggctgggctaagcagttccaagctttcc
atgtccaaggccctccctctcaccaaagtggttcagaatgatgcatacacagctcctgct
ctcccttcctctattcgaacaaaagccttgaccaacatgtcccggacactggtgaacaag
gaagaaccccccaaagagctgccagctgctgagcctgttctcagcccattggaaggcacc
aagatgactgtgaataatctgcaccctcgagtcactgaggaggacattgttgagcttttc
tgtgtgtgtggggccctcaagcgagctcgactggtccatcctggggtagcggaggtggtg
tttgtgaaaaaggacgatgccatcaccgcatataagaagtacaacaaccggtgtctggac
gggcagccgatgaagtgcaaccttcacatgaatgggaatgttatcacctcagaccagccc
atcctgctgcggctgagtgacagcccatcaatgaaaaaggagagcgagctgcctcgcagg
gtgaactctgcctcctcctccaacccccctgccgaagtggaccctgacaccatcctgaag
gcactcttcaagtcctcaggggcctctgtgaccacgcagcccacagaattcaaaatcaag
ctttga

DBGET integrated database retrieval system