KEGG   Homo sapiens (human): 84274
Entry
84274             CDS       T01001                                 
Symbol
COQ5, COQ10D9
Name
(RefSeq) coenzyme Q5, methyltransferase
  KO
K06127  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase [EC:2.1.1.201]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00130  Ubiquinone and other terpenoid-quinone biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00128  Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate + polyprenyl-PP => ubiquinol
Disease
H00999  Coenzyme Q10 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    84274 (COQ5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.201  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase
     84274 (COQ5)
SSDB
Motif
Pfam: Ubie_methyltran Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_8 Methyltransf_20
Other DBs
NCBI-GeneID: 84274
NCBI-ProteinID: NP_115690
OMIM: 616359
HGNC: 28722
Ensembl: ENSG00000110871
Pharos: Q5HYK3(Tbio)
UniProt: Q5HYK3
Position
12:complement(120503279..120529158)
AA seq 327 aa
MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVS
EEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDI
AFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVG
KQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAHRVLKPGG
RFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDM
IEDAGFHKVTYESLTSGIVAIHSGFKL
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggcccccgggagctgtgctctatggagctattgcggccgtgggtggtcgcgggcg
atgcggggctgccagctcctcgggcttcgtagctcttggcccggggacctactaagtgct
cggctcttgtcccaagagaagcgggcagcggaaacgcactttgggtttgagactgtgtcg
gaagaggagaaggggggcaaagtctatcaggtgtttgaaagtgtggctaagaagtatgat
gtgatgaatgatatgatgagtcttggtatccatcgtgtttggaaggatttgctgctctgg
aagatgcacccgcttcctgggacccagctgcttgatgttgctggaggcacaggtgacatt
gcattccggttccttaattatgttcagtcccagcatcagagaaaacagaagaggcagtta
agggcccaacaaaatttatcctgggaagaaattgccaaagagtaccagaatgaagaagat
tccttgggcgggtctcgtgtcgtggtgtgtgacatcaacaaggagatgctaaaggttgga
aagcagaaagccttggctcaaggatacagagctggacttgcatgggtattaggagatgct
gaagaactgccctttgatgatgacaagtttgatatttacaccattgcctttgggatccgg
aatgtcacacacattgatcaggcactccaggaagctcatcgggtgctgaaaccaggagga
cggtttctctgtctggaatttagccaagtgaacaatcccctcatatccaggctttatgat
ctatatagcttccaggtcatccctgtcctgggagaggtcatcgctggagactggaagtcc
tatcagtaccttgtagagagtatccgaaggtttccgtctcaggaagagttcaaggacatg
atagaagatgcaggctttcacaaggtgacttacgaaagtctaacatcaggcattgtggcc
attcattctggcttcaaactttaa

DBGET integrated database retrieval system