KEGG   Homo sapiens (human): 84275
Entry
84275             CDS       T01001                                 

Gene name
SLC25A33, BMSC-MCP, PNC1
Definition
(RefSeq) solute carrier family 25 member 33
  KO
K15116  solute carrier family 25, member 33/36
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    84275 (SLC25A33)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   84275 (SLC25A33)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 84275
NCBI-ProteinID: NP_115691
OMIM: 610816
HGNC: 29681
Ensembl: ENSG00000171612
Vega: OTTHUMG00000001322
Pharos: Q9BSK2(Tbio)
UniProt: Q9BSK2
Position
1p36.22
AA seq 321 aa
MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTIS
GAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFN
GIFVPNSNIVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQT
EGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAA
ALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIP
NTAIVLSTYELIVYLLEDRTQ
NT seq 966 nt   +upstreamnt  +downstreamnt
atggcgacgggcggccagcagaaggagaacacgctgcttcacctcttcgccggcgggtgt
ggaggcacagttggtgctattttcacttgtccactagaagtcattaagacacggttgcag
tcttcaagattagctctccggacagtctactatcctcaggttcatctggggaccattagt
ggagctggaatggtgagaccaacatccgtgacacctggactctttcaggttctgaagtcg
atcttggagaaagagggaccaaagtcactttttagaggcttgggtccaaatttggttgga
gttgcaccatcaagggctgtatactttgcatgttactccaaagccaaagagcaatttaat
ggcattttcgtgcctaacagcaatattgtgcatattttctcagctggctctgcagctttt
atcacaaattccttaatgaatcctatatggatggttaaaacccgaatgcagctagaacag
aaagtgaggggctctaagcagatgaatacactccagtgtgctcgttacgtttaccagacc
gaaggcattcgtggcttctatagaggattaactgcctcgtatgctggaatttccgaaact
ataatctgctttgctatttatgaaagtttaaagaagtatctgaaagaagctccattagcc
tcttctgcaaatgggactgagaaaaattccacaagtttttttggacttatggcagctgct
gctctttctaagggctgtgcctcctgcattgcttatccacacgaagtcataaggacgagg
ctccgggaagagggcaccaagtacaagtcttttgtccagacggcgcgcctggtgttccgg
gaagaaggctaccttgccttttatagaggactgtttgcccagcttatccggcagatccca
aatactgccattgtgttgtctacttatgagttaattgtgtacctgttagaagaccgtact
cagtaa

DBGET integrated database retrieval system