KEGG   Homo sapiens (human): 84281Help
Entry
84281             CDS       T01001                                 

Gene name
C2orf88, smAKAP
Definition
(RefSeq) chromosome 2 open reading frame 88
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SmAKAP
Motif
Other DBs
NCBI-GeneID: 84281
NCBI-ProteinID: NP_001035984
OMIM: 615117
HGNC: 28191
Ensembl: ENSG00000187699
Vega: OTTHUMG00000154361
Pharos: Q9BSF0(Tdark)
UniProt: Q9BSF0
Structure
PDB: 

Position
2q32.2
AA seq 95 aa AA seqDB search
MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILE
YAHRLSQDILCDALQQWACNNIKYHDIPYIESEGP
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcatgaaatcaaagcaaactttcccatttcctaccatatatgaaggtgagaag
cagcatgagagtgaagaaccctttatgccagaagagagatgtctacctaggatggcttct
ccagttaatgtcaaagaggaagtgaaggaacctccagggaccaatactgtgatcttggaa
tatgcacaccgcctgtctcaggatatcttgtgtgatgccttgcagcaatgggcatgcaat
aacatcaagtaccatgacattccatacattgagagtgaggggccttga

DBGET integrated database retrieval system