KEGG   Homo sapiens (human): 84282
Entry
84282             CDS       T01001                                 

Gene name
RNF135, L13, MMFD, REUL, Riplet
Definition
(RefSeq) ring finger protein 135
  KO
K16272  E3 ubiquitin-protein ligase RNF135 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Disease
H01308  Macrocephaly macrosomia facial dysmorphism syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    84282 (RNF135)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     84282 (RNF135)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    84282 (RNF135)
SSDB
Motif
Pfam: zf-C3HC4_4 SPRY zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4_2 zf-RING_2 zf-RING_5 PRY Prok-RING_4 zf-RING_10 C1_1 zf-MIZ
Other DBs
NCBI-GeneID: 84282
NCBI-ProteinID: NP_115698
OMIM: 611358
HGNC: 21158
Ensembl: ENSG00000181481
Vega: OTTHUMG00000132867
Pharos: Q8IUD6(Tbio)
UniProt: Q8IUD6
Position
17q11.2
AA seq 432 aa
MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACP
TCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRP
ELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDL
SMASPKLVTSDTAAGKIRDILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPL
PDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCERFSTS
QVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQLSAW
HMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLH
PGNYLIIKQVKV
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggcgggcctgggcctgggctccgccgttcccgtgtggctggccgaggacgacctcggc
tgcatcatctgccaggggctgctggactggcccgccacgctgccctgcggccacagcttc
tgccgccactgcctggaggccctgtggggcgcccgcgacgcccgccgctgggcctgcccc
acttgccgccagggcgccgcgcagcagccgcacctgcggaagaacacgctactgcaggac
ctggccgacaagtaccgccgcgccgcacgcgagatacaggcgggctccgaccctgcccac
tgcccctgcccgggctccagttccctctccagcgcggccgcgaggccccggcgccgcccg
gaactgcagcgggtggcagtagagaagagcatcacagaagttgctcaggagctgacagag
ctggtggaacatcttgtagacattgtcagaagcctgcagaatcagaggcccctatcagaa
tctggaccagacaacgaactgagcatcctgggcaaggctttttcttctggggtggatctt
tccatggcttctccaaagctggtgacttccgacacagctgcagggaaaatcagagatatt
ctccatgacctagaagaaattcaggaaaaattacaagaaagcgtcacctggaaagaggct
cctgaagcacaaatgcagggagaactcctggaagccccgtcttcctcctcatgcccattg
cctgaccagagccaccctgcactcaggagagcttctcggtttgctcagtgggccatccat
ccaacctttaacttgaagagcctttcctgcagcctggaggtgtccaaggattcccgtaca
gtgactgtgtctcaccgcccacaaccctatcgctggagctgtgagaggttttctaccagc
caggtcttatgttcccaggccctgtcttctggaaagcattactgggaagtggacactagg
aattgcagccactgggcagttggggtggcttcctgggagatgagccgcgaccaggtcctg
ggaaggactatggactcttgttgtgtggaatggaaggggactagccagctctctgcatgg
cacatggtcaaggaaactgtccttggctcagacagacctggggtggtgggcatctggctg
aaccttgaggagggaaagcttgccttctattcagtggacaatcaggagaagcttctgtat
gagtgtaccatctctgcctcctctcctttgtaccctgccttctggctgtatggcttacat
cctggaaattacctgataataaagcaagtaaaggtgtaa

DBGET integrated database retrieval system