KEGG   Homo sapiens (human): 84286
Entry
84286             CDS       T01001                                 
Symbol
TMEM175, hTMEM175
Name
(RefSeq) transmembrane protein 175
  KO
K24915  TMEM175 potassium channel family protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    84286 (TMEM175)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   84286 (TMEM175)
SSDB
Motif
Pfam: TMEM175 WTF
Other DBs
NCBI-GeneID: 84286
NCBI-ProteinID: NP_115702
OMIM: 616660
HGNC: 28709
Ensembl: ENSG00000127419
UniProt: Q9BSA9
Position
4:932460..958656
AA seq 504 aa
MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEI
SPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTI
TFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRAL
YRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREP
SAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLV
AALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQ
QTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMF
AKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLA
RPEHPPPAPTGQDDPQSQLLPAPC
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgtcccagccccggaccccagagcaggcactggatacaccgggggactgccccccaggc
aggagagacgaggacgctggggaggggatccagtgctcccaacgcatgctcagcttcagt
gacgccctgctgtccatcatcgccaccgtcatgatcctgcctgtgacccacacggagatc
tccccagaacagcagttcgacagaagtgtacagaggcttctggcaacacggattgccgtc
tacctgatgacctttctcatcgtgacagtggcctgggcagcacacacaaggttgttccaa
gttgttgggaaaacagacgacacacttgccctgctcaacctggcctgcatgatgaccatc
accttcctgccttacacgttttcgttaatggtgaccttccctgatgtgcctctgggcatc
ttcttgttctgtgtgtgtgtgatcgccattggggtcgtgcaggcactgattgtggggtac
gcattccacttcccgcacctgctgagcccgcagatccagcgctctgcccacagggctctg
taccgacgacacgtcctgggcatcgtcctccaaggcccggccctgtgctttgcagcggcc
atcttctctctcttctttgtccccttgtcttacctgctgatggtgactgtcatcctcctc
ccctatgtcagcaaggtcaccggctggtgcagagacaggctcctgggccacagggagccc
tcggctcacccagtggaagtcttctcgtttgacctccacgagccactcagcaaggagcgc
gtggaagccttcagcgacggagtctacgccatcgtggccacgcttctcatcctggacatc
tgcgaagacaacgtcccggaccccaaggatgtgaaggagaggttcagcggcagcctcgtg
gccgccctgagtgcgaccgggccgcgcttcctggcgtacttcggctccttcgccacagtg
ggactgctgtggttcgcccaccactcactcttcctgcatgtgcgcaaggccacgcgggcc
atggggctgctgaacacgctctcgctggccttcgtgggtggcctcccactagcctaccag
cagacctcggccttcgcccggcagccccgcgatgagctggagcgcgtgcgtgtcagctgc
accatcatcttcctggccagcatcttccagctggccatgtggaccacggcgctgctgcac
caggcggagacgctgcagccctcggtgtggtttggcggccgggagcatgtgctcatgttc
gccaagctggcgctgtacccctgtgccagcctgctggccttcgcctccacctgcctgctg
agcaggttcagtgtgggcatcttccacctcatgcagatcgccgtgccctgcgccttcctg
ttgctgcgcctgctcgtgggcctggccctggccaccctgcgggtcctgcggggcctcgcc
cggcccgaacaccccccgccagcccccacgggccaggacgacccacagtcccagctcctc
cctgccccctgctag

DBGET integrated database retrieval system