KEGG   Homo sapiens (human): 84289Help
Entry
84289             CDS       T01001                                 

Gene name
ING5, p28ING5
Definition
(RefSeq) inhibitor of growth family member 5
  KO
K11345  inhibitor of growth protein 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84289 (ING5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    HBO1 complex
     84289 (ING5)
    MOZ/MORF complex
     84289 (ING5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ING PHD Spc7 zf-HC5HC2H DUF4515
Motif
Other DBs
NCBI-GeneID: 84289
NCBI-ProteinID: NP_115705
OMIM: 608525
HGNC: 19421
Ensembl: ENSG00000168395
Vega: OTTHUMG00000151501
Pharos: Q8WYH8(Tbio)
UniProt: Q8WYH8
Structure
PDB: 

Position
2q37.3
AA seq 240 aa AA seqDB search
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQ
RVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDF
ESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP
VDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgccatgtacttggagcactatctggacagtatcgagaaccttccctgcgaa
cttcagaggaacttccagctgatgcgagagctggaccagaggacggaagataagaaagca
gagattgacatcctggctgcagagtacatctccacggtgaagacgctgtctccagaccag
cgcgtggagcgcctgcagaagatccagaacgcctacagcaagtgcaaggaatacagtgac
gacaaagtgcagctggccatgcagacctacgagatggtggataaacacattcgaaggctt
gatgcagacctggcgcgctttgaagcagatctgaaggacaagatggagggcagtgatttt
gaaagctccggagggcgagggttaaaaaaaggccggggtcagaaagaaaaaagagggtcc
cggggccgaggcaggaggacatcagaggaagacacaccaaagaaaaagaagcacaaagga
gggtctgagttcactgacaccatcctgtccgtgcacccctctgatgtgctggacatgccc
gtggacccaaacgaacccacgtactgcctgtgccaccaggtctcctatggggagatgatt
ggctgtgacaatccagactgtccaattgagtggtttcactttgcctgcgtggaccttacc
acgaaacccaaaggaaaatggttctgtccacggtgtgtccaggaaaagaggaagaagaag
tag

DBGET integrated database retrieval system