KEGG   Homo sapiens (human): 84290
Entry
84290             CDS       T01001                                 
Symbol
CAPNS2, CSS2
Name
(RefSeq) calpain small subunit 2
  KO
K08584  calpain, small subunit 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    84290 (CAPNS2)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C2: calpain family
   84290 (CAPNS2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 Ndufs5
Other DBs
NCBI-GeneID: 84290
NCBI-ProteinID: NP_115706
OMIM: 616767
HGNC: 16371
Ensembl: ENSG00000256812
Pharos: Q96L46(Tdark)
UniProt: Q96L46
Position
16:55566684..55567687
AA seq 248 aa
MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEP
PPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFS
LDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQA
AGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKE
WLQLTMYS
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtttcttgcaaaggctctattggaaggagcagatcgaggtcttggagaagctcttgga
ggcctctttggaggaggtggtcagagaagagaaggaggaggaagaaatattggagggata
gttggaggaattgtgaattttatcagtgaggctgcagcagctcagtatactccagaaccg
cctcccactcagcagcatttcaccagtgtggaggcctcagaaagtgaggaagttaggcga
tttcggcaacaatttacacagctggctggaccagacatggaggtgggtgccactgatctg
atgaatattctcaacaaagtcctttctaagcacaaagatcttaagactgacggttttagt
cttgacacctgccggagcattgtgtctgtcatggacagtgacacgactggtaagctgggc
tttgaagaatttaagtatctgtggaacaacatcaagaaatggcagtgtgtttataagcag
tatgacagggaccattctgggtctctgggaagttctcagctgcggggagctctgcaggcc
gcaggcttccagctaaatgaacaactttaccaaatgattgtccgccggtatgctaatgaa
gatggagatatggattttaacaatttcatcagctgcttggtccgcctggatgccatgttt
cgtgccttcaagtctctggatagagatagagatggcctgattcaagtgtctatcaaagaa
tggctgcagttgaccatgtattcctga

DBGET integrated database retrieval system