KEGG   Homo sapiens (human): 84292Help
Entry
84292             CDS       T01001                                 

Gene name
WDR83, MORG1
Definition
(RefSeq) WD repeat domain 83
  KO
K13124  mitogen-activated protein kinase organizer 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    84292 (WDR83)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    84292 (WDR83)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like
Motif
Other DBs
NCBI-GeneID: 84292
NCBI-ProteinID: NP_001093207
OMIM: 616850
HGNC: 32672
Ensembl: ENSG00000123154
Vega: OTTHUMG00000169356
Pharos: Q9BRX9(Tbio)
UniProt: Q9BRX9
Position
19p13.13
AA seq 315 aa AA seqDB search
MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLL
RTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEE
ATVILSGSIDSSIRCWDCRSRRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDL
RMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLD
CCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSV
QCWREEAYEAEDGAG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctttccctgagccaaagccgcggcctccagagctgccgcagaaacggttgaagacg
ctggactgcgggcagggggcagtgcgagccgtacgatttaatgtggatggcaattactgc
ctgacgtgcggcagtgacaagacgctgaagctgtggaacccgcttcgggggacgctgctg
cggacgtacagcggccacggctacgaggtgctggatgcggccggctcctttgacaacagt
agtctctgctccggcggcggggacaaggcggtggttctgtgggatgtggcatcagggcag
gtcgtgcgcaaattccggggccacgcagggaaggtgaacacggtgcagtttaatgaagag
gccacagttatcctgtccggctctattgattccagtatccgctgttgggattgccgctca
cggaggcctgagccagtgcagacgctggatgaggccagagatggcgtgtccagtgtgaag
gtgtcagaccacgagatcctggcaggctccgtggatggccgcgtgagacgctatgaccta
aggatggggcagctcttctcagactacgtgggcagccccatcacctgcacctgcttcagc
cgggatgggcagtgcaccctggtgtccagcctggactccacattgcggctcctggacaaa
gacacaggggagctgctgggcgagtacaagggccataagaaccaggaatacaagctggac
tgctgcctgagcgagcgtgacacacatgtggtcagctgttctgaggacgggaaggtgttc
ttctgggacctggtggagggtgcgctggctctggccctgcctgtgggttccggtgtggtg
cagtcgctggcctaccacccaacagagccctgcctgctgaccgccatgggaggcagcgtc
cagtgctggcgagaggaggcctatgaggcagaggatggagcaggctga

DBGET integrated database retrieval system