KEGG   Homo sapiens (human): 84295Help
Entry
84295             CDS       T01001                                 

Gene name
PHF6, BFLS, BORJ, CENP-31
Definition
(RefSeq) PHD finger protein 6
Organism
hsa  Homo sapiens (human)
Disease
H01915  Borjeson-Forssman-Lehmann syndrome
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 84295
NCBI-ProteinID: NP_001015877
OMIM: 300414
HGNC: 18145
Ensembl: ENSG00000156531
Vega: OTTHUMG00000022453
Pharos: Q8IWS0(Tbio)
UniProt: Q8IWS0
Structure
PDB: 

Position
Xq26.2
AA seq 365 aa AA seqDB search
MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNE
SLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPS
QGIYMVYCRKHKKTAHNSEADLEESFNEHELEPSSPKSKKKSRKGRPRKTNFKGLSEDTR
STSSHGTDEMESSSYRDRSPHRSSPSDTRPKCGFCHVGEEENEARGKLHIFNAKKAAAHY
KCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVKT
YHYHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGKVEIDQQQLTQQ
QLNGN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcagttgaacagaaaaaagggcctacaagacagcgcaaatgtggcttttgt
aagtcaaatagagacaaggaatgtggacagttactaatatctgaaaaccagaaggtggca
gcgcaccataagtgcatgctcttttcatctgctttggtatcatcacactctgataatgaa
agtcttggtggattttctattgaagatgtccaaaaggaaattaaaagaggcacgaagctg
atgtgttctttgtgccattgtcctggagcaacaattggttgtgatgtgaaaacatgtcac
aggacataccactaccactgtgcattgcatgataaagctcaaatacgagagaaaccttca
caaggaatttacatggtctattgccgaaaacacaagaaaactgcacataactccgaagct
gatttagaagaaagttttaatgaacatgaactggagccctcatcacctaaaagtaaaaag
aaaagtcgcaaaggaaggccaagaaaaactaattttaaagggctgtcagaagataccagg
tccacatcctcccatggaacagatgaaatggaaagtagttcctatagagataggtctcca
cacagaagcagccctagtgacaccaggcctaaatgtggattttgccatgtaggggaggaa
gaaaatgaagcacgaggaaaactgcatatatttaatgccaagaaggcagctgcccattat
aagtgcatgttgttttcttctggcacagtccagctcacaacaacatcaagagcagaattt
ggagactttgatattaaaactgtacttcaggagattaaacgaggaaaaagaatgaaatgt
acactttgcagtcagcctggtgctactattggatgtgaaataaaagcctgtgttaagact
taccattaccactgtggagtacaagacaaagctaaatacattgaaaatatgtcacgagga
atttacaaactatactgtaaaaatcatagtggaaatgatgagagagatgaagaagatgag
gaacgagagagtaaaagccgaggaaaagtagaaattgatcagcaacaactaactcagcag
caacttaatggaaactag

DBGET integrated database retrieval system