KEGG   Homo sapiens (human): 843Help
Entry
843               CDS       T01001                                 

Gene name
CASP10, ALPS2, FLICE2, MCH4
Definition
(RefSeq) caspase 10
  KO
K04400  caspase 10 [EC:3.4.22.63]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
hsa04622  RIG-I-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05152  Tuberculosis
hsa05161  Hepatitis B
Disease
H00108  Autoimmune lymphoproliferative syndromes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    843 (CASP10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    843 (CASP10)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    843 (CASP10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    843 (CASP10)
  09172 Infectious disease: viral
   05161 Hepatitis B
    843 (CASP10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    843 (CASP10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.63  caspase-10
     843 (CASP10)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C14: caspase family
   843 (CASP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 DED Imm30
Motif
Other DBs
NCBI-GeneID: 843
NCBI-ProteinID: NP_116756
OMIM: 601762
HGNC: 1500
Ensembl: ENSG00000003400
Vega: OTTHUMG00000132818
Pharos: Q92851(Tchem)
UniProt: Q92851
Position
2q33.1
AA seq 521 aa AA seqDB search
MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASD
VFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLY
ELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPK
LLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSN
GNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDR
QGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGR
FGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPE
QAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKT
MEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcaaggtcaacattggtattccagttcagataaaaactgtaaagtgagcttt
cgtgagaagcttctgattattgattcaaacctgggggtccaagatgtggagaacctcaag
tttctctgcataggattggtccccaacaagaagctggagaagtccagctcagcctcagat
gtttttgaacatctcttggcagaggatctgctgagtgaggaagaccctttcttcctggca
gaactcctctatatcatacggcagaagaagctgctgcagcacctcaactgtaccaaagag
gaagtggagcgactgctgcccacccgacaaagggtttctctgtttagaaacctgctctac
gaactgtcagaaggcattgactcagagaacttaaaggacatgatcttccttctgaaagac
tcgcttcccaaaactgaaatgacctccctaagtttcctggcatttctagagaaacaaggt
aaaatagatgaagataatctgacatgcctggaggacctctgcaaaacagttgtacctaaa
cttttgagaaacatagagaaatacaaaagagagaaagctatccagatagtgacacctcct
gtagacaaggaagccgagtcgtatcaaggagaggaagaactagtttcccaaacagatgtt
aagacattcttggaagccttaccgcaggagtcctggcaaaataagcatgcaggtagtaat
ggtaacagagccacaaatggtgcaccaagcctggtctccagggggatgcaaggagcatct
gctaacactctaaactctgaaaccagcacaaagagggcagctgtgtacaggatgaatcgg
aaccacagaggcctctgtgtcattgtcaacaaccacagctttacctccctgaaggacaga
caaggaacccataaagatgctgagatcctgagtcatgtgttccagtggcttgggttcaca
gtgcatatacacaataatgtgacgaaagtggaaatggagatggtcctgcagaagcagaag
tgcaatccagcccatgccgacggggactgcttcgtgttctgtattctgacccatgggaga
tttggagctgtctactcttcggatgaggccctcattcccattcgggagatcatgtctcac
ttcacagccctgcagtgccctagactggctgaaaaacctaaactctttttcatccaggcc
tgccaaggtgaagagatacagccttccgtatccatcgaagcagatgctctgaaccctgag
caggcacccacttccctgcaggacagtattcctgccgaggctgacttcctacttggtctg
gccactgtcccaggctatgtatcctttcggcatgtggaggaaggcagctggtatattcag
tctctgtgtaatcatctgaagaaattggtcccaaggatgctgaaatttctggaaaagaca
atggaaatcaggggcaggaagagaacagtgtggggtgctaaacagatctcagcaacctcc
ctgcccacggccatctctgcgcagacacctcgaccccccatgcgcaggtggagcagcgtt
tcctag

DBGET integrated database retrieval system