KEGG   Homo sapiens (human): 84301Help
Entry
84301             CDS       T01001                                 

Gene name
DDI2
Definition
(RefSeq) DNA damage inducible 1 homolog 2
  KO
K11885  DNA damage-inducible protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    84301 (DDI2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    84301 (DDI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp_protease gag-asp_proteas Asp_protease_2 ubiquitin RVP_2 RVP
Motif
Other DBs
NCBI-GeneID: 84301
NCBI-ProteinID: NP_115717
HGNC: 24578
Ensembl: ENSG00000197312
Vega: OTTHUMG00000002381
Pharos: Q5TDH0(Tdark)
UniProt: Q5TDH0
Structure
PDB: 

Position
1p36.21
AA seq 399 aa AA seqDB search
MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRS
LASYGLKDGDVVILRQKENADPRPPVQFPNLPRIDFSSIAVPGTSSPRQRQPPGTQQSHS
SPGEITSSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQ
DRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINC
KVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQ
IEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQTTFLPEGELPE
CARLAYGAGREDVRPEEIADQELAEALQKSAEDAERQKP
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcaccgtgtactgtgtgcggagggacctctccgaggtgaccttttccctccag
gtcgacgccgacttcgagctgcacaacttccgcgcgctgtgcgagctcgagtctggcatc
cccgcagccgagagccagatcgtctatgcggaaagacctctcacagacaaccacagatca
ttggcttcttatggcttgaaagatggggacgttgtgattttacgacagaaggagaatgca
gaccctcgacctccagtgcagttcccaaacttaccccgaatagatttcagtagtatagct
gtgcctggcacatcaagtccccggcagcgccagccaccaggaacacagcagtcccactca
tctcctggagaaataacttcatctcctcagggcttggacaatccagccttgctccgagat
atgttgctggccaacccgcatgagctgtccttgctgaaggaacgcaatccacccctggca
gaagctctgctcagtggagaccttgagaaattttctagagtcctggtggagcagcagcag
gaccgagcccggagagagcaagaaaggattcgtctgttttctgctgatccctttgacctt
gaagctcaggcaaagatagaagaagatataaggcaacagaacattgaggaaaacatgaca
atagctatggaagaggctccggaaagttttggccaagtagtgatgctttatattaactgc
aaagtgaatggacatcctgtgaaagcctttgttgactcaggtgcccagatgactatcatg
agccaagcttgtgcagaaaggtgtaacataatgagactggtggaccgtcggtgggcaggg
attgccaaaggagtgggcacccagaagattattggaagggtacatctagctcaggttcag
attgaaggagattttttgccatgttccttctctatacttgaggaacagcccatggacatg
cttctgggactggacatgcttaaacggcaccagtgttccatcgacctgaagaaaaatgta
ctcgtgatcggcaccacaggctcccagaccacctttcttcctgagggagagctaccagag
tgtgcccggttggcatatggggctggaagagaggatgtacggccagaggagattgcagac
caagaattagcagaagcccttcaaaaatcagcagaggatgcagagcgtcagaagccatga

DBGET integrated database retrieval system