KEGG   Homo sapiens (human): 84305
Entry
84305             CDS       T01001                                 

Gene name
PYM1, PYM, WIBG
Definition
(RefSeq) PYM homolog 1, exon junction complex associated factor
  KO
K14294  partner of Y14 and mago
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    84305 (PYM1)
   03015 mRNA surveillance pathway
    84305 (PYM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    84305 (PYM1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     84305 (PYM1)
Motif
Pfam: Mago-bind AAA_23 Nif11
Other DBs
NCBI-GeneID: 84305
NCBI-ProteinID: NP_115721
HGNC: 30258
Ensembl: ENSG00000170473
Vega: OTTHUMG00000170220
Pharos: Q9BRP8(Tbio)
UniProt: Q9BRP8
Position
12q13.2
AA seq 204 aa
MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELP
PGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEE
TAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPS
KEQLEKLARRRALEEELEDLELGL
NT seq 615 nt   +upstreamnt  +downstreamnt
atggaagctgccggcagccctgcggctacggagacaggcaagtatatcgcgtcaacacag
cgacctgacgggacctggcgcaagcagcggagggtgaaagaaggatatgtgccccaggag
gaggtcccagtatatgaaaacaagtatgtgaagtttttcaagagtaaaccagagttgccc
ccagggctaagccctgaggccactgctcctgtcaccccatccaggcctgaaggtggtgaa
ccaggcctctccaagacagccaaacgtaacctgaagcgaaaggagaagaggcggcagcag
caagagaaaggagaggcagaggccttgagcaggactcttgataaggtgtccctggaagag
acagcccaactccccagtgctccacagggctctcgggcagcccccacagctgcatctgac
cagcctgactcagctgccaccactgagaaagccaagaagataaagaacctaaagaagaaa
ctccggcaggtggaagagctgcagcagcggatccaggctggggaagtcagccagcctagc
aaagagcagctagaaaagctagcaaggaggagggcgctagaagaggagttagaggacttg
gagttaggcctctga

DBGET integrated database retrieval system