KEGG   Homo sapiens (human): 8431Help
Entry
8431              CDS       T01001                                 

Gene name
NR0B2, SHP, SHP1
Definition
(RefSeq) nuclear receptor subfamily 0 group B member 2
  KO
K08563  nuclear receptor subfamily 0 group B member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Disease
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    8431 (NR0B2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8431 (NR0B2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    8431 (NR0B2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Knirps/DAX 1-like
    8431 (NR0B2)
Nuclear receptors [BR:hsa03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   8431 (NR0B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep
Motif
Other DBs
NCBI-GeneID: 8431
NCBI-ProteinID: NP_068804
OMIM: 604630
HGNC: 7961
Ensembl: ENSG00000131910
Vega: OTTHUMG00000004231
Pharos: Q15466(Tbio)
UniProt: Q15466
Position
1p36.11
AA seq 257 aa AA seqDB search
MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREAL
DVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKK
ILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVP
GLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPI
IGDVDIAGLLGDMLLLR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagccaaccaggggcctgcccatgccagggagctgcaagccgccccgccatt
ctctacgcacttctgagctccagcctcaaggctgtcccccgaccccgtagccgctgccta
tgtaggcagcaccggcccgtccagctatgtgcacctcatcgcacctgccgggaggccttg
gatgttctggccaagacagtggccttcctcaggaacctgccatccttctggcagctgcct
ccccaggaccagcggcggctgctgcagggttgctggggccccctcttcctgcttgggttg
gcccaagatgctgtgacctttgaggtggctgaggccccggtgcccagcatactcaagaag
attctgctggaggagcccagcagcagtggaggcagtggccaactgccagacagaccccag
ccctccctggctgcggtgcagtggcttcaatgctgtctggagtccttctggagcctggag
cttagccccaaggaatatgcctgcctgaaagggaccatcctcttcaaccccgatgtgcca
ggcctccaagccgcctcccacattgggcacctgcagcaggaggctcactgggtgctgtgt
gaagtcctggaaccctggtgcccagcagcccaaggccgcctgacccgtgtcctcctcacg
gcctccaccctcaagtccattccgaccagcctgcttggggacctcttctttcgccctatc
attggagatgttgacatcgctggccttcttggggacatgcttttgctcaggtga

DBGET integrated database retrieval system