KEGG   Homo sapiens (human): 84311Help
Entry
84311             CDS       T01001                                 

Gene name
MRPL45, L45mt, MRP-L45
Definition
(RefSeq) mitochondrial ribosomal protein L45
  KO
K17426  large subunit ribosomal protein L45
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    84311 (MRPL45)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    84311 (MRPL45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tim44 P2_Phage_GpR
Motif
Other DBs
NCBI-GeneID: 84311
NCBI-ProteinID: NP_001265208
OMIM: 611850
HGNC: 16651
Ensembl: ENSG00000278845
Vega: OTTHUMG00000188489
UniProt: B4DEF8 A0A087WU62
Structure
PDB: 

Position
17q12
AA seq 256 aa AA seqDB search
MAAPIPQGFSCLSRFLGWWSRQPVLVTQSAAIVPVRTKKRFTPPIYQPKFKTEKEFMQHA
RKAGLVIPPEKSDRSIHLACTAGIFDAYVPPEGDARISSLSKEGLIERTERMKKTMASQV
SIRRIKDYDANFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTEHCFPTLAIYDRFGR
LMYGQEDVPKDVLEYVVFEKQLTNPYGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPE
EEYEEAQGEAQKPQLA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccccatacctcaagggttctcttgtttatcgaggtttttgggctggtggtct
cggcagccagttctggtgactcagtccgcagctatagttccagtaagaactaaaaaacgt
ttcacacctcctatttatcaacctaaatttaaaacagaaaaggagtttatgcaacatgcc
cggaaagcaggattggttattcctccagaaaaatcggaccgttccatacatctggcctgt
acagctggtatatttgatgcctatgttcctcctgagggtgatgcacgcatatcatctctt
tcaaaggagggactgatagagagaactgaacgaatgaagaagactatggcatcacaagtg
tcaatccggaggataaaagactatgatgccaactttaaaataaaggacttccctgaaaaa
gctaaggatatctttattgaagctcacctttgtctaaataactcagaccatgaccggctt
cataccttggtaactgaacactgttttccaactctggccatctatgaccggtttggccgg
ttgatgtatggacaggaagatgtacccaaggatgtcctggagtatgttgtattcgaaaag
cagttgacaaacccctatggaagctggagaatgcataccaagatcgttcccccatgggca
ccccctaagcagcccatccttaagacggtgatgatccctggccctcagctgaaaccagaa
gaagaatatgaagaggcacaaggagaggcccagaagcctcagctagcctga

DBGET integrated database retrieval system