KEGG   Homo sapiens (human): 84313Help
Entry
84313             CDS       T01001                                 

Gene name
VPS25, DERP9, EAP20, FAP20
Definition
(RefSeq) vacuolar protein sorting 25 homolog
  KO
K12189  ESCRT-II complex subunit VPS25
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Module
hsa_M00410  ESCRT-II complex
Network
N00183  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    84313 (VPS25)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-II complex
    84313 (VPS25)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   84313 (VPS25)
  Exosomal proteins of colorectal cancer cells
   84313 (VPS25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ESCRT-II
Motif
Other DBs
NCBI-GeneID: 84313
NCBI-ProteinID: NP_115729
OMIM: 610907
HGNC: 28122
Ensembl: ENSG00000131475
Vega: OTTHUMG00000180649
Pharos: Q9BRG1(Tbio)
UniProt: Q9BRG1 A0A024R1X3
Structure
PDB: 

Position
17q21.2
AA seq 176 aa AA seqDB search
MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLF
NNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQ
NNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgagtttcgagtggccgtggcagtatcgcttcccacccttctttacgttacaa
ccgaatgtggacactcggcagaagcagctggccgcctggtgctcgctggtcctgtccttc
tgccgcctgcacaaacagtccagcatgacggtgatggaagctcaggagagcccgctcttc
aacaacgtcaagctacagcgaaagcttcctgtggagtcgatccagattgtattagaggaa
ctgaggaagaaagggaacctcgagtggttggataagagcaagtccagcttcctgatcatg
tggcggaggccagaagaatgggggaaactcatctatcagtgggtttccaggagtggccag
aacaactccgtctttaccctgtatgaactgactaatggggaagacacagaggatgaggag
ttccacgggctggatgaagccactctactgcgggctctgcaggccctacagcaggagcac
aaggccgagatcatcactgtcagcgatggccgaggcgtcaagttcttctag

DBGET integrated database retrieval system