KEGG   Homo sapiens (human): 84315Help
Entry
84315             CDS       T01001                                 

Gene name
MON1A, SAND1
Definition
(RefSeq) MON1 homolog A, secretory trafficking associated
  KO
K20195  vacuolar fusion protein MON1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84315 (MON1A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   Others
    84315 (MON1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mon1
Motif
Other DBs
NCBI-GeneID: 84315
NCBI-ProteinID: NP_115731
OMIM: 611464
HGNC: 28207
Ensembl: ENSG00000164077
Vega: OTTHUMG00000156737
Pharos: Q86VX9(Tbio)
UniProt: Q86VX9
Position
3p21.31
AA seq 652 aa AA seqDB search
MHPGGGPSRAERLELGLGRERPAKAIFLHRRPGEGGGRERCLRCGHVCVRRGPGPREAVP
SGRPRPDTLTPPWVRQRAVTGTFCASWTPLRNRRAQRMATDMQRKRSSECLDGTLTPSDG
QSMERAESPTPGMAQGMEPGAGQEGAMFVHARSYEDLTESEDGAASGDSHKEGTRGPPPL
PTDMRQISQDFSELSTQLTGVARDLQEEMLPGSSEDWLEPPGAVGRPATEPPREGTTEGD
EEDATEAWRLHQKHVFVLSEAGKPVYSRYGSEEALSSTMGVMVALVSFLEADKNAIRSIH
ADGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIYYQILSLLTGAQLSHIFQQKQNYD
LRRLLSGSERITDNLLQLMARDPSFLMGAARCLPLAAAVRDTVSASLQQARARSLVFSIL
LARNQLVALVRRKDQFLHPIDLHLLFNLISSSSSFREGEAWTPVCLPKFNAAGFFHAHIS
YLEPDTDLCLLLVSTDREDFFAVSDCRRRFQERLRKRGAHLALREALRTPYYSVAQVGIP
DLRHFLYKSKSSGLFTSPEIEAPYTSEEEQERLLGLYQYLHSRAHNASRPLKTIYYTGPN
ENLLAWVTGAFELYMCYSPLGTKASAVSAIHKLMRWIRKEEDRLFILTPLTY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccgggggcgggccgagtcgggctgagcggctggagctgggccttggccgcgag
aggccggcgaaagctatcttcctgcaccggcggccgggtgagggcggtgggagggagcgg
tgcctgcgctgtggccatgtctgtgtacgcagggggccggggccccgcgaagctgtgccc
tcaggccggccccggccggacacccttacccctccatgggtccggcagagggcagtgacc
ggcaccttctgtgcgtcctggactcctctgagaaacaggagagctcaaaggatggctact
gacatgcagaggaagagaagcagcgaatgccttgatggcacattgactccttctgatgga
cagagtatggagagagctgagagccccacaccaggaatggcccagggaatggagccaggt
gcgggccaggagggtgccatgttcgtccatgcccgttcctacgaggacctgactgagtca
gaggatggggcagcttctggggacagccacaaggagggtaccaggggtcccccgccgctg
cctacagacatgcgccagatcagccaggactttagcgagctaagcacccagctgacgggt
gtggcccgggacctgcaggaggagatgctgccaggaagctctgaggattggctggaaccc
ccaggggcagttgggcgaccagccacagagccccccagggagggcacaaccgagggggat
gaggaggatgccacggaggcatggcgcctgcaccagaagcatgtctttgtgctgagtgag
gcagggaagcctgtgtactcccgctatgggtctgaggaggcactttccagcactatgggt
gttatggtggccctggtgtccttcctggaggcagacaagaacgccatccgctccatccat
gcagatggctacaaggtagtattcgtgcgccggagcccgctggtgctagtggcggtggct
cgtacgcggcagtcggcacaagagctggcgcaggagctgctctacatctactaccagatc
ctaagccttcttaccggtgcgcagctgagccacatcttccagcagaagcagaactatgat
ttgcggcgcctactctcgggctcagagcgcatcaccgacaacctgctgcagctcatggca
cgagaccccagcttcctgatgggggcggcacggtgcctgcccctggcggcggccgtgcgc
gacactgtgagcgccagcctgcagcaggcgcgtgcgcgcagcctggtcttctccatcctg
ctggcccgcaaccagctcgtggcactcgtgcgccgaaaggaccaatttctgcaccccatc
gacctgcacctgctcttcaacctcattagttcctcctcgtcctttcgcgagggcgaggcc
tggacgcccgtgtgcctgcccaaattcaacgcagccggcttcttccacgcacacatctct
tacctagagcctgacactgacctctgcctgctgcttgtctccactgaccgtgaggacttc
tttgcagtctctgactgccgccgccgcttccaggagcgccttcgcaagcgcggagcccac
ctggccctgcgagaggcactgcgcacaccctactacagcgttgcccaagtgggcatccct
gacctgcgtcacttcctctataagtcaaagagctcgggactcttcaccagccctgagatt
gaggccccatacaccagtgaagaggagcaggagcggctgctgggcctctaccagtacttg
cacagtcgtgcccacaatgcctctcgcccactcaagaccatttactacacgggccccaac
gagaacctcctggcctgggtgacaggcgcctttgagctctacatgtgttacagccccctg
gggaccaaggcgtcagccgtcagtgccatccataagctgatgcgctggatccgcaaagag
gaagaccgcctcttcattctcacgcccctcacctattga

DBGET integrated database retrieval system