KEGG   Homo sapiens (human): 84320Help
Entry
84320             CDS       T01001                                 

Gene name
ACBD6
Definition
(RefSeq) acyl-CoA binding domain containing 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ACBP Ank_5 Ank_2 Ank Ank_4 Ank_3
Motif
Other DBs
NCBI-GeneID: 84320
NCBI-ProteinID: NP_115736
OMIM: 616352
HGNC: 23339
Ensembl: ENSG00000230124
Vega: OTTHUMG00000035117
Pharos: Q9BR61(Tbio)
UniProt: Q9BR61 A0A024R949 B2RAA8
Structure
PDB: 

Position
1q25.2-q25.3
AA seq 282 aa AA seqDB search
MASSFLPAGAITGDSGGELSSGDDSGEVEFPHSPEIEETSCLAELFEKAAAHLQGLIQVA
SREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKK
LDPGWNPQIPEKKGKEANTGFGGPVISSLYHEETIREEDKNIFDYCRENNIDHITKAIKS
KNVDVNVKDEEGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHYASACEFLDI
VELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatcattcctgcccgcgggggccatcaccggcgacagcggtggagagctgagc
tcaggggacgactccggggaggtggagttcccccatagccctgagatcgaggagaccagt
tgcctggccgagctgtttgagaaggctgccgcgcacctgcaaggcctgattcaggtggcc
agcagggagcagctcttgtacctgtatgccaggtacaaacaggtcaaagttggaaattgt
aatactcctaaaccaagcttctttgattttgaaggaaagcaaaaatgggaagcttggaaa
gcacttggtgattcaagccccagccaagcaatgcaggaatatatcgcagtagttaaaaaa
ctagatccaggttggaatcctcagataccagagaagaaaggaaaagaagcaaatacaggt
tttggtgggccagttattagttctctatatcatgaagaaaccatcagggaagaagacaaa
aatatatttgattactgcagggaaaacaacattgaccatataaccaaagccatcaaatcg
aaaaatgtggatgtgaatgtgaaagatgaagagggtagggctctacttcactgggcctgt
gatcgaggacataaggaactagtcacagtgttgctgcaacatagagctgacattaactgt
caggacaatgaaggccaaacagctctacattatgcctctgcctgtgagtttctggatatt
gtagagctgctgctccagtctggtgctgaccccactctccgagaccaggatggctgcctg
ccagaggaggtgacaggctgcaaaacagtttctttggtgctgcagcggcacacaactggc
aaggcttaa

DBGET integrated database retrieval system