KEGG   Homo sapiens (human): 84329
Entry
84329             CDS       T01001                                 

Gene name
HVCN1, HV1, VSOP
Definition
(RefSeq) hydrogen voltage gated channel 1
  KO
K22644  voltage-gated hydrogen channel 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    84329 (HVCN1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Proton channel, voltage-gated (Hv)
   84329 (HVCN1)
SSDB
Motif
Pfam: VGPC1_C Ion_trans
Other DBs
NCBI-GeneID: 84329
NCBI-ProteinID: NP_001035196
OMIM: 611227
HGNC: 28240
Ensembl: ENSG00000122986
Vega: OTTHUMG00000169530
Pharos: Q96D96(Tbio)
UniProt: Q96D96
Structure
PDB: 
3A2A 5OQK

Position
12q24.11
AA seq 273 aa
MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPT
PVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAEL
ILDLKIIQPDKNNYAAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVV
SFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSERQLLRLKQMNVQLAA
KIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN
NT seq 822 nt   +upstreamnt  +downstreamnt
atggccacctgggacgaaaaggcagtcacccgcagggccaaggtggctcccgctgagagg
atgagcaagttcttaaggcacttcacggtcgtgggagacgactaccatgcctggaacatc
aactacaagaaatgggagaatgaagaggaggaggaggaggaggagcagccaccacccaca
ccagtctcaggcgaggaaggcagagctgcagcccctgacgttgcccctgcccctggcccc
gcacccagggccccccttgacttcaggggcatgttgaggaaactgttcagctcccacagg
tttcaggtcatcatcatctgcttggtggttctggatgccctcctggtgcttgctgagctc
atcctggacctgaagatcatccagcccgacaagaataactatgctgccatggtattccac
tacatgagcatcaccatcttggtcttttttatgatggagatcatctttaaattatttgtc
ttccgcctggagttctttcaccacaagtttgagatcctggatgccgtcgtggtggtggtc
tcattcatcctcgacattgtcctcctgttccaggagcaccagtttgaggctctgggcctg
ctgattctgctccggctgtggcgggtggcccggatcatcaatgggattatcatctcagtt
aagacacgttcagaacggcaactcttaaggttaaaacagatgaatgtacaattggccgcc
aagattcaacaccttgagttcagctgctctgagaaggaacaagaaattgaaagacttaac
aaactattgcgacagcatggacttcttggtgaagtgaactag

DBGET integrated database retrieval system