KEGG   Homo sapiens (human): 84333Help
Entry
84333             CDS       T01001                                 

Gene name
PCGF5, RNF159
Definition
(RefSeq) polycomb group ring finger 5
  KO
K11489  polycomb group RING finger protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    84333 (PCGF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84333 (PCGF5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     84333 (PCGF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-C3HC4_4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-RING_10 zf-Nse Prok-RING_4 zf-RING_6 zf-rbx1
Motif
Other DBs
NCBI-GeneID: 84333
NCBI-ProteinID: NP_001243478
OMIM: 617407
HGNC: 28264
Ensembl: ENSG00000180628
Vega: OTTHUMG00000018740
Pharos: Q86SE9(Tdark)
UniProt: Q86SE9
Structure
PDB: 

Position
10q23.32
AA seq 256 aa AA seqDB search
MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQV
HETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVD
EEGDENEDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFL
SLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLY
QSYPMVLQYRPRIDFG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaaaggaaacacttggtgaaagattttaatccttacattacctgctatatc
tgtaaagggtatctgatcaagccaacaacagtgacggaatgcctccatacattctgtaag
acttgtattgttcagcactttgaagatagcaatgattgcccaaggtgtggcaaccaagtt
catgagacaaatccattagaaatgttgaggttggacaatacattagaggaaattatattt
aagctggtccctggactacgagaacaagaacttgagcgtgaatctgaattttggaagaaa
aataagcctcaagaaaatggacaagatgatacttcaaaagctgacaaaccgaaagtagat
gaagaaggtgatgaaaatgaagatgataaagattatcacagaagtgacccacaaattgct
atctgtctagattgtttacgaaataatgggcaatcaggggacaatgtagtaaagggttta
atgaagaaattcattcgatgttctacacgtgtaactgtgggaactattaaaaaatttcta
agtttaaaactaaaacttccaagttcttatgagttggatgtgctgtgcaatggtgaaatt
atggggaaggatcatactatggaattcatctacatgacaagatggcgactaagaggcgaa
aactttcggtgtctgaactgctcagcttcgcaagtctgctctcaggatggccctttgtat
cagtcataccctatggtactgcagtatcgaccaagaattgatttcggttag

DBGET integrated database retrieval system