KEGG   Homo sapiens (human): 84334Help
Entry
84334             CDS       T01001                                 

Gene name
COA8, APOP, APOP1, APOPT1, C14orf153
Definition
(RefSeq) cytochrome c oxidase assembly factor 8
  KO
K23506  apoptogenic protein 1
Organism
hsa  Homo sapiens (human)
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    84334 (COA8)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    84334 (COA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2315 DUF31
Motif
Other DBs
NCBI-GeneID: 84334
NCBI-ProteinID: NP_001289581
OMIM: 616003
HGNC: 20492
Ensembl: ENSG00000256053
Vega: OTTHUMG00000153929
Pharos: Q96IL0(Tdark)
UniProt: Q96IL0
Position
14q32.33
AA seq 183 aa AA seqDB search
MVVLRAGKKTFLPPLCRAFACRGCQLAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPD
KYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTK
GLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRLVQAQFCHHLLHGKSGPGKDL
EQA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcttgcgggcggggaagaagacctttctcccccctctctgccgcgccttcgcc
tgccgcggctgtcaactcgctccggagcgcggcgccgagcgcagggatacggcgcccagc
ggggtctcaagattctgccctccaagaaagtcttgccatgattggataggacccccagat
aaatattcaaaccttcgacctgttcacttttacatacctgaaaatgaatctccattggaa
caaaagcttagaaaattaagacaagaaacacaagaatggaatcaacagttctgggcaaac
cagaatttgacttttagtaaggaaaaagaagaatttattcactcaagactaaaaactaaa
ggcctgggcctgagaactgaatcaggtcagaaagcaacattgaatgcagaagaaatggcg
gacttctacaaggaatttttaagtaaaaattttcagaagcacatgtattataacagattg
gtacaagcgcaattttgccatcaccttcttcatgggaaaagtggccctggaaaggatttg
gaacaagcttaa

DBGET integrated database retrieval system