KEGG   Homo sapiens (human): 8434
Entry
8434              CDS       T01001                                 
Symbol
RECK, ST15
Name
(RefSeq) reversion inducing cysteine rich protein with kazal motifs
  KO
K17461  reversion-inducing-cysteine-rich protein with kazal motifs
Organism
hsa  Homo sapiens (human)
Pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    8434 (RECK)
SSDB
Motif
Pfam: Kazal_2 Kazal_1 DB Ldl_recept_a DNA_pol_E_B
Other DBs
NCBI-GeneID: 8434
NCBI-ProteinID: NP_066934
OMIM: 605227
HGNC: 11345
Ensembl: ENSG00000122707
Pharos: O95980(Tbio)
UniProt: O95980 A8K9D8
Position
9:36036913..36124455
AA seq 971 aa
MATVRASLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSE
SRLKHLLQRAPDYCPETMVEIWNCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQA
SSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQI
KAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNACKRILMSKKTEM
EIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPPSTGLDGAKLHCCSKANTST
CRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGCRNLTYCTNFN
NRPTELFRSCNAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIACSLQIK
PCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRP
STLGNIVEEVTHPCNPNPCPANELCEVNRKGCPSGDPCLPYFCVQGCKLGEASDFIVRQG
TLIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNV
CSCFAGNLVCSTRLCLSEHSSEDDRRTFTGLPCNCADQFVPVCGQNGRTYPSACIARCVG
LQDHQFEFGSCMSKDPCNPNPCQKNQRCIPKPQVCLTTFDKFGCSQYECVPRQLACDQVQ
DPVCDTDHMEHNNLCTLYQRGKSLSYKGPCQPFCRATEPVCGHNGETYSSVCAAYSDRVA
VDYYGDCQAVGVLSEHSSVAECASVKCPSLLAAGCKPIIPPGACCPLCAGMLRVLFDKEK
LDTIAKVTNKKPITVLEILQKIRMHVSVPQCDVFGYFSIESEIVILIIPVDHYPKALQIE
ACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSVPSAGVRARPSCHSLLLPLSL
GLALHLLWTYN
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggcgaccgtccgggcctctctgcgaggtgcgctgctccttctgctggccgtggcgggg
gtcgcggaggtggcagggggcctggctccgggcagtgcgggtgcattgtgttgtaatcat
tcaaaggataaccaaatgtgccgtgatgtatgtgaacagattttctcctcaaaaagtgaa
tcccgactaaaacatctgttgcagcgagccccagattattgcccagagacaatggttgaa
atttggaattgtatgaattcatctttgccaggtgtgtttaagaagtctgatggctgggtt
ggcttaggctgctgtgaactggctattgccttggagtgtcgacaggcatgcaagcaggca
tcttcaaagaatgatatttccaaagtttgcagaaaagaatatgagaatgctcttttcagt
tgcattagcagaaatgaaatgggctcggtttgttgcagttatgcaggtcatcacacaaac
tgccgagaatactgtcaagccatttttcgaacagactcttctcctggtccatctcagata
aaagcagtggaaaattattgcgcctctattagtccacaattaatacattgtgtgaacaat
tatactcaatcttatccaatgaggaacccaacggatagtttatattgctgtgacagagct
gaagaccatgcttgccaaaatgcctgcaagagaatcctgatgtccaagaaaacggaaatg
gagattgttgatggtctcatcgagggttgtaagacccagcccttgcctcaagatcctctt
tggcaatgttttcttgaaagctcacaatctgttcaccctggagtcactgtacaccctcct
ccctctacaggcctcgatggggctaaattgcattgttgttctaaagcaaacacttcaaca
tgtagggaactctgcactaaactttacagcatgagctggggcaatacacagagttggcaa
gagtttgatcgcttttgtgaatataatccagtggaagtgtccatgttgacctgtttagcg
gatgtccgggaaccttgccagttgggctgtagaaaccttacttactgtactaattttaac
aacaggccaacagaacttttcaggagttgtaatgcacagtcagatcaaggagccatgaat
gacatgaagttgtgggagaaaggaagcataaagatgccatttatcaatatacctgttctt
gatattaaaaagtgccagccagagatgtggaaagcaatagcttgttcactgcagattaaa
ccttgtcatagtaaatctcggggaagtattatttgcaaatcagattgtgtggagattctt
aaaaaatgtggagaccagaacaaattccctgaagaccacacagctgaaagtatttgtgag
cttctgtcacctacagatgatctgaagaattgtatacctttggatacatacctcaggcca
agtactttaggtaacattgtagaagaagtgactcatccctgtaacccaaatccttgccct
gccaatgagctctgtgaagtaaaccgaaaaggatgtccatctggagatccctgtcttcca
tacttttgtgttcaaggttgcaaactgggagaagcttctgatttcattgtccgtcaaggg
acactaatccaggtgccatcatctgcaggggaagttggttgttataaaatctgttcatgt
ggacaaagtggactcttagaaaactgtatggaaatgcactgtatagacctccagaagtct
tgtattgttggaggaaaaagaaaaagtcatggaacatcctttagtattgactgcaatgtc
tgttcttgttttgctggcaatttggtgtgctctacccgcctttgcctcagtgagcacagt
tcagaagatgaccgtcgtaccttcacaggtctgccctgtaactgtgcagatcagtttgtc
cctgtatgtgggcagaatgggcgcacttaccccagtgcctgcattgctcgctgtgtgggc
ctccaagaccatcagtttgagtttggatcatgcatgtcaaaggatccatgtaatcctaat
ccctgccaaaaaaaccaaaggtgcatacccaaaccacaggtctgcctgacgacttttgat
aaatttggatgtagccagtatgagtgtgtaccaagacagctcgcgtgtgaccaggtccaa
gatcctgtttgtgacacagaccacatggagcacaacaatctctgcactttataccaaaga
ggaaaaagcctctcttacaaaggtccctgccagcccttttgcagagcaaccgagcccgta
tgtgggcacaatggtgagacctacagcagtgtgtgtgctgcctactcggatcgcgtggca
gtcgattactatggggactgccaggccgtcggagtcctctcagagcacagctccgtcgcc
gagtgtgcttctgtcaagtgtccttcgctcttggcagctggatgcaaacccatcatccca
ccgggtgcttgttgcccattatgtgctgggatgttaagagttttatttgacaaagaaaaa
ctggatactattgctaaggtaacaaataaaaagccaataacagttctggaaatacttcag
aaaatccgcatgcacgtgtctgtcccacagtgtgatgtgtttggatacttcagcattgaa
tcagaaattgtgatcctgatcattcccgtcgatcactatccaaaagctctgcagattgaa
gcctgcaataaagaagcagagaagattgagtcccttatcaactctgacagcccgactttg
gcgtcccatgtccctctctctgccctcatcatttcccaggtacaggtctccagcagtgtg
ccatcggccggtgtcagggccaggccttcttgccactccctcctccttcccctcagcttg
ggccttgccttgcacttgctctggacatataactga

DBGET integrated database retrieval system