KEGG   Homo sapiens (human): 84340Help
Entry
84340             CDS       T01001                                 

Gene name
GFM2, EF-G2mt, EFG2, MRRF2, MST027, MSTP027, RRF, RRF2, RRF2mt, hEFG2, mEF-G_2
Definition
(RefSeq) G elongation factor mitochondrial 2
  KO
K02355  elongation factor G
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    84340 (GFM2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    84340 (GFM2)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   84340 (GFM2)
 Prokaryotic type
   84340 (GFM2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    84340 (GFM2)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    84340 (GFM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU EFG_II EFG_C EFG_IV GTP_EFTU_D2 RF3_C MMR_HSR1 AvrPtoB_bdg AIG1 FeoB_N
Motif
Other DBs
NCBI-GeneID: 84340
NCBI-ProteinID: NP_115756
OMIM: 606544
HGNC: 29682
Ensembl: ENSG00000164347
Vega: OTTHUMG00000102058
Pharos: Q969S9(Tbio)
UniProt: Q969S9 A0A024RAK1
Position
5q13.3
AA seq 779 aa AA seqDB search
MLTNLRIFAMSHQTIPSVYINNICCYKIRASLKRLKPHVPLGRNCSSLPGLIGNDIKSLH
SIINPPIAKIRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERG
ITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVW
RQADKHNIPRICFLNKMDKTGASFKYAVESIREKLKAKPLLLQLPIGEAKTFKGVVDVVM
KEKLLWNCNSNDGKDFERKPLLEMNDPELLKETTEARNALIEQVADLDDEFADLVLEEFS
ENFDLLPAEKLQTAIHRVTLAQTAVPVLCGSALKNKGIQPLLDAVTMYLPSPEERNYEFL
QWYKDDLCALAFKVLHDKQRGPLVFMRIYSGTIKPQLAIHNINGNCTERISRLLLPFADQ
HVEIPSLTAGNIALTVGLKHTATGDTIVSSKSSALAAARRAEREGEKKHRQNNEAERLLL
AGVEIPEPVFFCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGMGELHI
EIIHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLDRTLGDKRHLVTVEVEARPIET
SSVMPVIEFEYAESINEGLLKVSQEAIENGIHSACLQGPLLGSPIQDVAITLHSLTIHPG
TSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNIQEIQT
RQDNKVVIGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMNPQDQNTLLNRRSGLT
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccaacttgaggatatttgcaatgagtcatcagacaatacccagtgtgtatatt
aataatatatgctgctataaaataagagcaagtttaaaaagattaaagccacatgtgccg
cttggaagaaattgcagttctctaccaggcttaataggaaatgatatcaaatcccttcat
tccatcatcaatcctcccatagctaaaatccgtaatattggaattatggctcatattgat
gcaggcaaaactaccaccacagaaagaatattgtactattccggatatacaagatcactg
ggagatgttgatgatggagacacagtgacagatttcatggcccaagagcgagaaagaggc
attactattcaatcagctgctgttacatttgattggaaaggttatagagtcaatctaatt
gatacaccaggtcatgtggactttaccttggaggttgagcggtgcctaagagtgttggat
ggtgcagtggctgtatttgatgcctctgctggtgtagaggcccagactctcacagtatgg
aggcaagctgataaacacaatatacctcgaatctgttttttaaacaagatggacaaaact
ggagcaagctttaagtatgcagttgaaagcatcagagagaagttaaaggcaaagcctttg
cttttacagttaccaattggtgaagccaaaactttcaaaggagtggtggatgtagtaatg
aaagaaaaacttctttggaattgcaattcaaatgatggaaaagactttgagagaaagccc
ctcttggaaatgaatgatcctgaattgctgaaggaaacaactgaagcaaggaatgcctta
attgaacaagttgcagatttggatgatgaatttgctgacttggttttagaagaatttagt
gagaattttgatttgttaccagctgaaaagctacagactgcaatacatagagtgacacta
gctcagacagcagtgcctgtgctttgtggaagtgccctgaaaaacaaagggatacagccc
ttgttagatgctgttactatgtacttaccttcacctgaagagcgtaactatgaatttctg
cagtggtataaggatgacttatgtgcattggcatttaaagttctccatgacaagcagcga
ggaccactggtttttatgcgcatttactcaggcactataaaaccccagttggccattcat
aatattaatggaaactgcacggagagaataagtcgtctgcttttgccgtttgctgaccaa
catgtagaaatcccttcattgactgctggtaacattgctttgactgttgggcttaaacat
actgccactggagacaccattgtctcatccaagtccagtgcattagctgcagctcgtaga
gccgaacgggagggagaaaagaagcacagacaaaacaatgaagcagagagacttttattg
gctggagtggagattccagaacctgttttcttctgtaccatagaacccccatcactgtct
aagcagccagatttggaacatgcgttgaaatgtcttcagcgtgaagatcccagtttgaaa
gtgaggctagatcctgactctggacaaactgttctgtgtggtatgggggagttacatata
gagattattcatgatcgaatcaagagggaatatggactggagacctatctcgggcctctc
caggtggcatatcgagagaccatcctaaactcagttcgtgccacagataccttagataga
actttaggagacaaaaggcatcttgtgactgtagaagtggaagcaaggccaattgaaaca
tcatctgttatgcctgtgattgagtttgagtatgctgaaagtatcaatgaaggccttttg
aaggtctcccaagaggccattgaaaatggaattcacagcgcatgtctccaaggaccattg
cttggatccccaattcaggatgtagcaattactttacattccctgacaattcatcctggc
acctccacaactatgatttctgcctgtgtctcaagatgcgtgcaaaaggctctgaagaaa
gctgataagcaagttttggagcctctgatgaatcttgaggttacagtagctagagattat
ctcagccctgtcctggcagatctggcacaaagaagaggaaacattcaggaaattcagact
cgccaggacaacaaagttgttattggatttgttcccttagcagaaattatgggttattca
actgtgcttcgaacgctaacatcaggctcagctacttttgccttagaactatctacttat
caagccatgaatcctcaagatcaaaatacactgctcaaccggagaagtggtttgacctaa

DBGET integrated database retrieval system