KEGG   Homo sapiens (human): 84342
Entry
84342             CDS       T01001                                 

Gene name
COG8, CDG2H, DOR1
Definition
(RefSeq) component of oligomeric golgi complex 8
  KO
K20295  conserved oligomeric Golgi complex subunit 8
Organism
hsa  Homo sapiens (human)
Disease
H00119  Congenital disorders of glycosylation type II
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84342 (COG8)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   Conserved oligomeric Golgi (COG) complex
    84342 (COG8)
SSDB
Motif
Pfam: Dor1 Vps51 Vps54_N
Other DBs
NCBI-GeneID: 84342
NCBI-ProteinID: NP_115758
OMIM: 606979
HGNC: 18623
Ensembl: ENSG00000213380
Vega: OTTHUMG00000186023
Pharos: Q96MW5(Tbio)
UniProt: Q96MW5 A0A024R6Z6
Position
16q22.1
AA seq 612 aa
MATAATIPSVATATAAALGEVEDEGLLASLFRDRFPEAQWRERPDVGRYLRELSGSGLER
LRREPERLAEERAQLLQQTRDLAFANYKTFIRGAECTERIHRLFGDVEASLGRLLDRLPS
FQQSCRNFVKEAEEISSNRRMNSLTLNRHTEILEILEIPQLMDTCVRNSYYEEALELAAY
VRRLERKYSSIPVIQGIVNEVRQSMQLMLSQLIQQLRTNIQLPACLRVIGYLRRMDVFTE
AELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEASRVHLFDIITQYRAIFSDEDPLL
PPAMGEHTVNESAIFHGWVLQKVSQFLQVLETDLYRGIGGHLDSLLGQCMYFGLSFSRVG
ADFRGQLAPVFQRVAISTFQKAIQETVEKFQEEMNSYMLISAPAILGTSNMPAAVPATQP
GTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFH
RAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNL
GHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGR
AETQAEPPSVGP
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggcgaccgcggcgactatcccatcggtagccacggccacagcagcggctctcggcgag
gtggaggatgaagggctcctggcgtcgctgttccgggaccgcttccccgaggcccagtgg
cgcgagcggcccgatgtgggccgctacctccgggagttgagcggctcggggctggagcgg
ctgcggcgcgagcccgagcgcctggcggaggagcgggcgcagctgctgcagcagacgcgc
gacttggccttcgctaactacaagaccttcatccgcggcgccgagtgcaccgagcgcatc
caccgcctgtttggcgacgtggaggcgtcgctcggccgcctgctcgaccgtttgcccagc
ttccagcagagctgcaggaactttgtgaaggaagccgaggagatcagctccaaccgccgg
atgaatagcctgaccctaaaccggcacacagaaattttggaaatactggagattcctcag
ctcatggacacctgtgtccggaacagttattatgaagaggccctggagcttgcagcctac
gtacgccgactggagaggaaatactcttccatccctgtcatccagggcatcgtgaacgaa
gtgcgccagtccatgcagctgatgctgagccagctgatccagcaactgaggaccaacatc
cagcttcctgcctgcctccgtgtcattggctacctgcggcgcatggacgtcttcactgag
gctgagttgagggtgaagtttcttcaggcccgagatgcttggctccggtccatcctgact
gccattcctaatgatgatccctatttccatattacaaaaaccatcgaggcctcccgtgtc
catctctttgatatcatcacccagtaccgtgccatcttctcagacgaggacccactgctg
ccccctgccatgggtgagcacactgtgaatgagagtgccatcttccatggctgggtgcta
cagaaggtctcacaattcctgcaggtgctggagaccgacctttaccggggcataggcggc
cacctggactctctgctgggccagtgcatgtactttgggctgtccttcagccgggtggga
gctgatttccggggtcagttggctcctgttttccagcgggtggccatcagcactttccag
aaagcaattcaggaaacagtggagaaattccaggaagaaatgaactcctacatgctcatc
tcggctccagccatcctgggcaccagtaacatgcctgctgctgtgccagccacccagccg
gggacgctgcagccacccatggtgctcctagatttcccacccctcgcctgctttctcaac
aatattctggttgccttcaatgatctgcgcctctgctgccctgtggccctggcgcaggat
gtgactggggccttggaagatgcccttgccaaggtaactaaaataatcctggccttccat
cgcgctgaagaggctgccttcagcagcggggagcaagagctctttgtccagttctgcact
gtcttcctggaagaccttgttccgtatttaaatcgctgtctccaagtcctttttccacca
gctcagatagcacagactttaggcattcctcccactcagctctccaagtacggtaaccta
gggcatgtgaacatcggcgccattcaggagcccctcgcctttatcctgccaaagagagag
acgcttttcaccctggatgaccaggcgctggggcccgagctcacagctccagcaccagag
cctcccgccgaggagccacgcctggagcccgcgggcccagcctgcccggagggagggcga
gcggagacgcaggccgaaccgcccagcgtggggccctag

DBGET integrated database retrieval system