KEGG   Homo sapiens (human): 8436
Entry
8436              CDS       T01001                                 
Symbol
CAVIN2, PS-p68, SDPR, SDR, cavin-2
Name
(RefSeq) caveolae associated protein 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PTRF_SDPR
Other DBs
NCBI-GeneID: 8436
NCBI-ProteinID: NP_004648
OMIM: 606728
HGNC: 10690
Ensembl: ENSG00000168497
Pharos: O95810(Tbio)
UniProt: O95810
Position
2:complement(191834310..191847088)
AA seq 425 aa
MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLT
LLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRK
VSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAV
EGKEELPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKVEESRAEKIKRSSLKKVD
SLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRK
KVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGEIAEEAAEKAT
SRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQ
VHQTS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgggagaggacgctgcacaggccgaaaagttccagcaccctgggtctgacatgcggcag
gaaaagccctcgagccccagcccgatgccttcctccacaccaagccccagcctgaaccta
gggaacacagaggaggccatccgggacaactcacaggtgaacgcagtcacggtgctcacg
ctcctggacaagctggtgaacatgctagacgctgtgcaggagaaccagcacaagatggag
cagcgacagatcagtttggagggctccgtgaagggcatccagaatgacctcaccaagctc
tccaagtaccaggcctccaccagcaacacggtgagcaagctgctggagaagtcccgcaag
gtcagcgcccacacgcgcgcggtcaaagagcgcatggataggcagtgcgcacaggtgaag
cggctggagaacaaccacgcccagctcctccgacgcaaccatttcaaagtgctcatcttc
caggaggaaaatgagatccctgccagcgtgtttgtgaaacagcccgtttccggtgccgtg
gaagggaaggaggagcttccggatgaaaacaaatccctggaggaaaccctgcacaccgtg
gacctctcctcagatgatgatttgccccacgatgaggaggccctggaagacagtgccgag
gaaaaggtggaagaaagtagggcagagaaaataaaaagatccagcctgaagaaagtggat
agcctcaagaaagcattttctcgccagaacatcgagaaaaagatgaacaagctggggaca
aagatcgtatctgtagagaggagagagaagattaagaaatctctcacgtcaaatcaccag
aaaatatcctcaggaaaaagctcccccttcaaggtttctcccctcactttcgggcggaag
aaagtccgagagggagaaagccatgcagaaaatgagaccaagtcagaagacctgcctagc
agtgagcagatgccaaatgaccaggaagaggagtcctttgcagagggtcattccgaagcg
tccctcgccagcgctctggtggaaggggaaattgcagaggaggctgctgagaaggcgacc
tccagggggagtaactcggggatggacagcaacatcgacttgactattgtggaagatgaa
gaggaggagtcagtggccctggaacaggcacagaaggtacgctatgagggtagctacgcg
ctaacatccgaggaggcggagcgctccgatggggaccccgtgcagcccgccgtgctccag
gtgcaccagacctcctga

DBGET integrated database retrieval system