KEGG   Homo sapiens (human): 84364
Entry
84364             CDS       T01001                                 
Symbol
ARFGAP2, IRZ, NBLA10535, ZFP289, ZNF289
Name
(RefSeq) ADP ribosylation factor GTPase activating protein 2
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84364 (ARFGAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84364 (ARFGAP2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    84364 (ARFGAP2)
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 84364
NCBI-ProteinID: NP_115765
OMIM: 606908
HGNC: 13504
Ensembl: ENSG00000149182
UniProt: Q8N6H7
Structure
Position
11:complement(47164301..47176879)
AA seq 521 aa
MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQ
LGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPAWDAPATEPSGTQQPAPS
TESSGLAQPEHGPNTDLLGTSPKASLELKSSIIGKKKPAAAKKGLGAKKGLGAQKVSSQS
FSEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQELQIDRKKEEKKLQNLEGKKR
EQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGTFASGPPKYKD
NPFSLGESFGSRWDTDAAWGMDRVEEKEPEVTISSIRPISERATNRREVESRSSGLESSE
ARQKFAGAKAISSDMFFGREVDAEYEARSRLQQLSGSSAISSSDLFGDMDGAHGAGSVSL
GNVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggcggcggagccgaacaagaccgaaatccagactctttttaagaggcttcgcgcagtt
ccaaccaacaaggcctgtttcgactgcggcgccaagaatccgagttgggccagcatcacg
tacggtgttttcttgtgcattgactgttccggggtgcaccgctccctgggcgtccatctg
agcttcatcaggtccacagagttggattccaactggaactggttccagctgaggtgtatg
caggtcggcgggaatgccaatgcgacggctttttttcgccaacatggatgcacagccaat
gatgccaacaccaaatataatagccgagctgcccagatgtaccgggagaagatccggcag
ctggggagtgcggccctggctaggcatggcactgatctttggatagacaacatgagtagt
gccgttcctaatcactccccagagaagaaggactctgatttcttcacagaacacactcaa
ccccctgcctgggatgcgccagccactgagccttcagggacccagcagccagccccgtct
acagagagcagtggcctggcacagccggagcatggccccaacacagacctgcttggcacc
tcacccaaagcctcactggaactgaaaagctccatcattggcaagaagaagccagcagca
gctaagaaagggctgggtgccaagaaaggcctaggggcccagaaggtgagcagccagagc
ttcagtgagattgagcggcaggctcaggtggcagagaagctccgtgagcagcaggcagcc
gatgccaagaagcaggcggaggagtccatggtcgcctccatgcgtctggcctaccaggag
ctccagattgatcgtaagaaagaggaaaagaagctacagaatctggaagggaagaagcga
gagcaggcagaaaggttgggcatgggcttggtatcccgaagctctgtctcccactccgtg
ctgtctgagatgcaggtgattgagcaggaaaccccagtgagtgcaaaatcctctcgctcg
cagctggacttgtttgacgatgttggtactttcgcctctggacccccaaagtacaaggac
aatcccttttccttaggggaaagctttggctcccgctgggatacagatgctgcctggggt
atggacagggtagaggagaaggagccagaagtgaccatctcaagcatccggcctatttca
gaaagagccacaaaccggagggaagtggagagccggagctcaggcctcgagtctagtgag
gcgcgtcagaaattcgcaggagccaaagccatctcatctgacatgttctttgggcgggag
gtggatgcagagtatgaggccaggtctcggctgcagcagctctcaggcagcagtgccatc
agctcttcagacctctttggggacatggatggagctcacggagcaggaagtgtatctctg
gggaacgtgctgcctacagcggacattgcccagtttaagcagggtgtcaagtctgtggct
gggaaaatggctgtgctggccaatggtgtgatgaattccttgcaggatcgctacggttcc
tactga

DBGET integrated database retrieval system