KEGG   Homo sapiens (human): 84366
Entry
84366             CDS       T01001                                 

Gene name
PRAC1, C17orf92, PRAC
Definition
(RefSeq) PRAC1 small nuclear protein
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 84366
NCBI-ProteinID: NP_115767
OMIM: 609819
HGNC: 30591
Ensembl: ENSG00000159182
Vega: OTTHUMG00000159899
Pharos: Q96KF2(Tdark)
UniProt: Q96KF2
Position
17q21.32
AA seq 57 aa
MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP
NT seq 174 nt   +upstreamnt  +downstreamnt
atgttgtgcgcccatttctcagatcaaggaccggcccatcttactacctccaagagtgct
tttctctctaataagaaaacatctactttgaaacatctactgggcgagaccaggagtgat
ggctcagcctgtaattctggaatttcgggaggccgaggcaggaagattccttga

DBGET integrated database retrieval system