KEGG   Homo sapiens (human): 8437Help
Entry
8437              CDS       T01001                                 

Gene name
RASAL1, RASAL
Definition
(RefSeq) RAS protein activator like 1
  KO
K17632  RAS protein activator-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8437 (RASAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 RasGAP PH BTK
Motif
Other DBs
NCBI-GeneID: 8437
NCBI-ProteinID: NP_004649
OMIM: 604118
HGNC: 9873
Ensembl: ENSG00000111344
Vega: OTTHUMG00000169705
Pharos: O95294(Tbio)
UniProt: O95294
Position
12q24.13
AA seq 804 aa AA seqDB search
MAKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRSLGPFWGEEYTVH
LPLDFHQLAFYVLDEDTVGHDDIIGKISLSREAITADPRGIDSWINLSRVDPDAEVQGEI
CLSVQMLEDGQGRCLRCHVLQARDLAPRDISGTSDPFARVFWGSQSLETSTIKKTRFPHW
DEVLELREMPGAPSPLRVELWDWDMVGKNDFLGMVEFSPKTLQQKPPKGWFRLLPFPRAE
EDSGGNLGALRVKVRLIEDRVLPSQCYQPLMELLMESVQGPAEEDTASPLALLEELTLGD
CRQDLATKLVKLFLGRGLAGRFLDYLTRREVARTMDPNTLFRSNSLASKSMEQFMKLVGM
PYLHEVLKPVISRVFEEKKYMELDPCKMDLGRTRRISFKGALSEEQMRETSLGLLTGYLG
PIVDAIVGSVGRCPPAMRLAFKQLHRRVEERFPQAEHQDVKYLAISGFLFLRFFAPAILT
PKLFDLRDQHADPQTSRSLLLLAKAVQSIGNLGQQLGQGKELWMAPLHPFLLQCVSRVRD
FLDRLVDVDGDEAGVPARALFPPSAIVREGYLLKRKEEPAGLATRFAFKKRYVWLSGETL
SFSKSPEWQMCHSIPVSHIRAVERVDEGAFQLPHVMQVVTQDGTGALHTTYLQCKNVNEL
NQWLSALRKASAPNPNKLAACHPGAFRSARWTCCLQAERSAAGCSRTHSAVTLGDWSDPL
DPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLEADTGACPEVLARQRAATARLLEVLA
DLDRAHEEFQQQERGKAALGPLGP
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggccaagagcagctccctgaatgttcgcgtggtggagggccgcgcgctgcctgccaag
gacgtgtctgggagcagcgacccctactgcctagtgaaagtggacgacgaggtggtggcc
aggacagctactgtctggaggagcctgggccccttctggggggaggagtacacggtgcac
ctgcctctggatttccaccagctggccttctacgtgctggatgaggacactgtcgggcac
gacgacatcatcggcaagatctcgctgagcagggaggcgattacagccgacccccgaggg
attgacagctggattaacttgagccgagtggacccagatgcagaagtgcagggtgagatc
tgcctgtcagtgcagatgctggaggatgggcagggccgctgccttcgctgccatgtgctt
caggccagggacctggctcccagagacatctctggcacatctgacccatttgcacgtgtg
ttttggggcagccagagcttggagacctcaaccatcaagaagactcgcttcccgcactgg
gatgaagtgctggagctgcgggagatgccaggtgccccgtccccactgcgggtggagctc
tgggactgggacatggtgggcaagaatgacttcttgggcatggtggagttctctccaaag
accctccagcagaagccacctaaaggctggttccgcctcctgccctttcccagagccgag
gaggattctggggggaacctgggtgccctgcgagtgaaggtacgcctgattgaggaccgc
gtcctgccctcccagtgctaccagcctctcatggagctgctcatggagtctgtgcagggg
ccagcagaggaggacactgctagccccttggctttgctggaagagctgaccttgggggac
tgccgccaggaccttgccaccaagctggtgaaactctttcttggccggggactggctggg
cgctttctggactatctcacccggcgtgaggtggctcggaccatggaccccaacaccctc
ttccgttctaactccctggcatccaagtcgatggaacagtttatgaagctcgtgggcatg
ccctacctgcacgaggtcctgaagcctgtgattagccgtgtctttgaggagaagaagtac
atggagctggatccctgcaagatggacctgggccgcacccggaggatctccttcaaaggc
gcactctcggaggagcagatgcgggagaccagcctggggctgctgacgggctacctgggg
cccatcgtggacgccatcgtgggctccgtggggcgctgcccgcccgccatgcgcctcgcc
ttcaagcagctgcaccggcgagtggaggagcgcttcccccaggccgagcaccaggatgtg
aagtacctggccatcagtggatttctcttcttgcgattcttcgcacctgccatccttacc
ccaaagctgtttgaccttcgggaccaacacgcggacccccagactagccgctcactgctg
ttgcttgccaaggctgtgcagagcattggaaacctgggccagcagctgggccaaggcaag
gaactgtggatggcccccctgcaccccttcctgctgcagtgtgtctcacgtgtgagagac
ttcctggaccggctggtggatgtggatggggatgaagctggtgtcccagccagggccctg
ttcccgccctcggccattgttcgagaaggctatctgctgaagcgcaaggaggagcctgcc
ggcctggccacgcgctttgccttcaagaagcgctacgtctggctcagcggggagaccctc
tccttctccaagagtcctgagtggcagatgtgtcactccatccccgtgtctcacatccgc
gccgtggagcgcgtagacgagggcgccttccaactgccccacgtgatgcaggtggtgacg
caggacggcacgggggcgctgcacaccacctacctccagtgcaagaatgtgaatgagctc
aaccagtggctctcggccttgcgcaaggccagcgcccccaacccgaacaagctggccgcc
tgccaccccggtgccttccgcagcgcgcgctggacctgctgcctccaggctgagcgctca
gccgccggctgcagccgtacacactcagctgtcaccctgggggactggagtgacccactg
gatcctgatgctgaggcccagacagtgtatcggcagctgctcctggggcgggaccagctc
aggctgaaattactggaggattctaacatggatacaactctggaggcagacacaggggcc
tgtcctgaggtcctggcccggcaaagagcagcaactgcccgcctgctggaggtgctcgca
gacctggatcgtgcccacgaggagttccagcagcaggagcgagggaaggcggccctgggc
ccccttggcccctaa

DBGET integrated database retrieval system