KEGG   Homo sapiens (human): 8438Help
Entry
8438              CDS       T01001                                 

Gene name
RAD54L, HR54, RAD54A, hHR54, hRAD54
Definition
(RefSeq) RAD54 like
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    8438 (RAD54L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     8438 (RAD54L)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     8438 (RAD54L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Helicase_C ResIII HDA2-3 DEAD Rad54_N
Motif
Other DBs
NCBI-GeneID: 8438
NCBI-ProteinID: NP_001136020
OMIM: 603615
HGNC: 9826
Ensembl: ENSG00000085999
Vega: OTTHUMG00000007772
Pharos: Q92698(Tbio)
UniProt: Q92698 A8K996
Position
1p34.1
AA seq 747 aa AA seqDB search
MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTN
QPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVL
YEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCI
MADEMGLGKTLQCITLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQP
LAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHR
LKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELP
ILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ
TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDL
FPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLY
VRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPAND
EQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGE
LKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVL
QAAWDAASTAITFVFHQRSHEEQRGLR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggagcttggctcccagccagctggccaagagaaaacctgaaggcaggtcctgt
gatgatgaagactggcaacctggcctagtgactcctaggaaacggaaatccagcagtgag
acccagatccaggagtgtttcctgtctccttttcggaaacctttgagtcagctaaccaat
caaccaccttgtctggacagcagtcagcatgaagcatttattcgaagcattttgtcaaag
cctttcaaagtccccattccaaattatcaaggtcctctgggctctcgagcattgggcctg
aaaagggctggggtccgccgggccctccatgaccccctggaaaaagatgccttggttctg
tatgagcctcccccgctgagcgctcatgaccagctgaagcttgacaaggagaaactccct
gtccatgtggttgttgaccctattctcagtaaggttttgcggcctcatcagagagaggga
gtgaaattcctgtgggagtgtgtcaccagtcggcgcatccctggcagccatggctgcatc
atggctgatgagatgggcctaggaaagacgctgcagtgcatcacattgatgtggacactt
ttacgccagagtccagagtgcaagccagaaattgacaaggcagtggtggtgtcgccttcc
agcctggtgaagaactggtacaatgaggttgggaaatggctcggagggaggatccaacct
ctggccatcgatggaggatctaaggatgaaatagaccaaaagctggaaggattcatgaac
cagcgtggagccagggtgtcttctcccatcctcatcatttcctatgagaccttccgcctt
catgttggagtcctccagaaaggaagtgttggtctggtcatatgtgacgagggacacagg
ctcaagaactctgagaatcagacttaccaagccctggacagcttgaacaccagccggcgg
gtgctcatctccggaactcccatccagaatgatctgcttgagtatttcagcttggtacat
tttgttaattccggcatcctagggactgcccatgaattcaagaagcattttgaattgcca
attttgaagggtcgagacgctgctgctagtgaggcagacaggcagctaggagaggagcgg
ctgcgggagctcaccagcattgtgaatagatgcctgatacggaggacttctgatatcctt
tctaaatatctgcctgtgaagattgagcaggtcgtttgttgtaggctgacaccccttcag
actgagttatacaagaggtttctgagacaagccaaaccggcagaagaattgcttgagggc
aagatgagtgtgtcttccctttcttccatcacctcgctaaagaagctttgtaatcatcca
gctctaatctatgataagtgtgtggaagaggaggatggctttgtgggtgccttggacctc
ttccctcctggttacagctctaaggccctggagccccagctgtcaggtaagatgctggtc
ctggattatattctggcggtgacccgaagccgtagcagtgacaaagtagtgctggtgtcg
aattacacccagactttggatctctttgagaagctgtgccgtgcccgaaggtacttatac
gtccgcctggatggcacgatgtccattaagaagcgagccaaggttgtagaacgcttcaat
agtccatcgagccctgactttgtcttcatgctgagcagcaaagctgggggctgtggcctc
aatctcattggggctaaccggctggtcatgtttgaccctgactggaacccagccaatgat
gaacaagccatggcccgggtctggcgagatggtcaaaagaagacttgctatatctaccgc
ctgctgtctgcagggaccattgaggagaagatcttccagcgtcagagccacaagaaggca
ctgagcagctgtgtggtggatgaggagcaggatgtagagcgccacttctctctgggcgag
ttgaaggagctgtttatcctggatgaagctagcctcagtgacacacatgacaggttgcac
tgccgacgttgtgtcaacagccgtcagatccggccaccccctgatggttctgactgcact
tcagacctggcagggtggaaccactgcactgataagtgggggctccgggatgaggtactc
caggctgcctgggatgctgcctccactgccatcaccttcgtcttccaccagcgttctcat
gaggagcagcggggcctccgctga

DBGET integrated database retrieval system