KEGG   Homo sapiens (human): 8440Help
Entry
8440              CDS       T01001                                 

Gene name
NCK2, GRB4, NCKbeta
Definition
(RefSeq) NCK adaptor protein 2
  KO
K19862  NCK adaptor protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04360  Axon guidance
hsa04660  T cell receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    8440 (NCK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    8440 (NCK2)
  09158 Development
   04360 Axon guidance
    8440 (NCK2)
 09160 Human Diseases
  09167 Infectious diseases
   05130 Pathogenic Escherichia coli infection
    8440 (NCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 hSH3 SH2_2
Motif
Other DBs
NCBI-GeneID: 8440
NCBI-ProteinID: NP_001004720
OMIM: 604930
HGNC: 7665
Ensembl: ENSG00000071051
Vega: OTTHUMG00000153116
Pharos: O43639(Tbio)
UniProt: O43639 A0A0S2Z4M6
Structure
PDB: 

Position
2q12.2
AA seq 380 aa AA seqDB search
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFL
SLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaagttattgtgatagccaagtgggactacaccgcccagcaggaccaggag
ctggacatcaagaagaacgagcggctgtggttgctggacgactccaagacgtggtggcgg
gtgaggaacgcggccaacaggacgggctatgtaccgtccaactacgtggagcggaagaac
agcctgaagaagggctccctcgtgaagaacctgaaggacacactaggcctcggcaagacg
cgcaggaagaccagcgcgcgggatgcgtcccccacgcccagcacggacgccgagtacccc
gccaatggcagcggcgccgaccgcatctacgacctcaacatcccggccttcgtcaagttc
gcctatgtggccgagcgggaggatgagttgtccctggtgaaggggtcgcgcgtcaccgtc
atggagaagtgcagcgacggttggtggcggggcagctacaacgggcagatcggctggttc
ccctccaactacgtcttggaggaggtggacgaggcggctgcggagtccccaagcttcctg
agcctgcgcaagggcgcctcgctgagcaatggccagggctcccgcgtgctgcatgtggtc
cagacgctgtaccccttcagctcagtcaccgaggaggagctcaacttcgagaagggggag
accatggaggtgattgagaagccggagaacgaccccgagtggtggaaatgcaaaaatgcc
cggggccaggtgggcctcgtccccaaaaactacgtggtggtcctcagtgacgggcctgcc
ctgcaccctgcgcacgccccacagataagctacaccgggccctcgtccagcgggcgcttc
gcgggcagagagtggtactacgggaacgtgacgcggcaccaggccgagtgcgccctcaac
gagcggggcgtggagggcgacttcctcattagggacagcgagtcctcgcccagcgacttc
tccgtgtcccttaaagcgtcagggaagaacaaacacttcaaggtgcagctcgtggacaat
gtctactgcattgggcagcggcgcttccacaccatggacgagctggtggaacactacaaa
aaggcgcccatcttcaccagcgagcacggggagaagctctacctcgtcagggccctgcag
tga

DBGET integrated database retrieval system