KEGG   Homo sapiens (human): 8440Help
Entry
8440              CDS       T01001                                 

Gene name
NCK2, GRB4, NCKbeta
Definition
(RefSeq) NCK adaptor protein 2
  KO
K19862  NCK adaptor protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04360  Axon guidance
hsa04660  T cell receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    8440 (NCK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    8440 (NCK2)
  09158 Development
   04360 Axon guidance
    8440 (NCK2)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05130 Pathogenic Escherichia coli infection
    8440 (NCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Motif
Other DBs
NCBI-GeneID: 8440
NCBI-ProteinID: NP_001004720
OMIM: 604930
HGNC: 7665
Ensembl: ENSG00000071051
Vega: OTTHUMG00000153116
Pharos: O43639(Tbio)
UniProt: O43639 A0A0S2Z4M6
Structure
PDB: 

Position
2q12.2
AA seq 380 aa AA seqDB search
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFL
SLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaagttattgtgatagccaagtgggactacaccgcccagcaggaccaggag
ctggacatcaagaagaacgagcggctgtggttgctggacgactccaagacgtggtggcgg
gtgaggaacgcggccaacaggacgggctatgtaccgtccaactacgtggagcggaagaac
agcctgaagaagggctccctcgtgaagaacctgaaggacacactaggcctcggcaagacg
cgcaggaagaccagcgcgcgggatgcgtcccccacgcccagcacggacgccgagtacccc
gccaatggcagcggcgccgaccgcatctacgacctcaacatcccggccttcgtcaagttc
gcctatgtggccgagcgggaggatgagttgtccctggtgaaggggtcgcgcgtcaccgtc
atggagaagtgcagcgacggttggtggcggggcagctacaacgggcagatcggctggttc
ccctccaactacgtcttggaggaggtggacgaggcggctgcggagtccccaagcttcctg
agcctgcgcaagggcgcctcgctgagcaatggccagggctcccgcgtgctgcatgtggtc
cagacgctgtaccccttcagctcagtcaccgaggaggagctcaacttcgagaagggggag
accatggaggtgattgagaagccggagaacgaccccgagtggtggaaatgcaaaaatgcc
cggggccaggtgggcctcgtccccaaaaactacgtggtggtcctcagtgacgggcctgcc
ctgcaccctgcgcacgccccacagataagctacaccgggccctcgtccagcgggcgcttc
gcgggcagagagtggtactacgggaacgtgacgcggcaccaggccgagtgcgccctcaac
gagcggggcgtggagggcgacttcctcattagggacagcgagtcctcgcccagcgacttc
tccgtgtcccttaaagcgtcagggaagaacaaacacttcaaggtgcagctcgtggacaat
gtctactgcattgggcagcggcgcttccacaccatggacgagctggtggaacactacaaa
aaggcgcccatcttcaccagcgagcacggggagaagctctacctcgtcagggccctgcag
tga

DBGET integrated database retrieval system