KEGG   Homo sapiens (human): 84417Help
Entry
84417             CDS       T01001                                 

Gene name
ECRG4, C2orf40
Definition
(RefSeq) ECRG4 augurin precursor
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Augurin DUF1700
Motif
Other DBs
NCBI-GeneID: 84417
NCBI-ProteinID: NP_115787
OMIM: 611752
HGNC: 24642
Ensembl: ENSG00000119147
Vega: OTTHUMG00000130921
Pharos: Q9H1Z8(Tbio)
UniProt: Q9H1Z8
Position
2q12.2
AA seq 148 aa AA seqDB search
MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKE
FLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQ
RHYDEDSAIGPRSPYGFRHGASVNYDDY
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcccccgcgcggcctgctgtcctggccctgaccgggctggcgctgctcctg
ctcctgtgctggggcccaggtggcataagtggaaataaactcaagctgatgcttcaaaaa
cgagaagcacctgttccaactaagactaaagtggccgttgatgagaataaagccaaagaa
ttccttggcagcctgaagcgccagaagcggcagctgtgggaccggactcggcccgaggtg
cagcagtggtaccagcagtttctctacatgggctttgacgaagcgaaatttgaagatgac
atcacctattggcttaacagagatcgaaatggacatgaatactatggcgattactaccaa
cgtcactatgatgaagactctgcaattggtccccggagcccctacggctttaggcatgga
gccagcgtcaactacgatgactactaa

DBGET integrated database retrieval system