KEGG   Homo sapiens (human): 8443Help
Entry
8443              CDS       T01001                                 

Gene name
GNPAT, DAP-AT, DAPAT, DHAPAT, RCDP2
Definition
(RefSeq) glyceronephosphate O-acyltransferase
  KO
K00649  glyceronephosphate O-acyltransferase [EC:2.3.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa04146  Peroxisome
Disease
H00207  Rhizomelic chondrodysplasia punctata
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    8443 (GNPAT)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    8443 (GNPAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.42  glycerone-phosphate O-acyltransferase
     8443 (GNPAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-GeneID: 8443
NCBI-ProteinID: NP_055051
OMIM: 602744
HGNC: 4416
Ensembl: ENSG00000116906
Vega: OTTHUMG00000038024
Pharos: O15228(Tchem)
UniProt: O15228
Position
1q42.2
AA seq 680 aa AA seqDB search
MESSSSSNSYFSVGPTSPSAVVLLYSKELKKWDEFEDILEERRHVSDLKFAMKCYTPLVY
KGITPCKPIDIKCSVLNSEEIHYVIKQLSKESLQSVDVLREEVSEILDEMSHKLRLGAIR
FCAFTLSKVFKQIFSKVCVNEEGIQKLQRAIQEHPVVLLPSHRSYIDFLMLSFLLYNYDL
PVPVIAAGMDFLGMKMVGELLRMSGAFFMRRTFGGNKLYWAVFSEYVKTMLRNGYAPVEF
FLEGTRSRSAKTLTPKFGLLNIVMEPFFKREVFDTYLVPISISYDKILEETLYVYELLGV
PKPKESTTGLLKARKILSENFGSIHVYFGDPVSLRSLAAGRMSRSSYNLVPRYIPQKQSE
DMHAFVTEVAYKMELLQIENMVLSPWTLIVAVLLQNRPSMDFDALVEKTLWLKGLTQAFG
GFLIWPDNKPAEEVVPASILLHSNIASLVKDQVILKVDSGDSEVVDGLMLQHITLLMCSA
YRNQLLNIFVRPSLVAVALQMTPGFRKEDVYSCFRFLRDVFADEFIFLPGNTLKDFEEGC
YLLCKSEAIQVTTKDILVTEKGNTVLEFLVGLFKPFVESYQIICKYLLSEEEDHFSEEQY
LAAVRKFTSQLLDQGTSQCYDVLSSDVQKNALAACVRLGVVEKKKINNNCIFNVNEPATT
KLEEMLGCKTPIGKPATAKL
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggagtcttccagttcatctaactcttatttctccgttggcccaaccagtcccagcgct
gtcgtgctcctctactcgaaggagctcaaaaagtgggatgagtttgaagatattttagaa
gagaggaggcatgtcagtgacttgaaatttgcaatgaaatgctacacacctcttgtctat
aagggaattactccatgtaaaccaattgatattaaatgtagtgttctcaattctgaggag
attcattatgtcattaaacagctttccaaggaatcccttcaatctgtggatgtcctccga
gaggaagtgagtgagatcttagatgaaatgagtcacaaactgcgtcttggagccattcgg
ttttgtgccttcaccctgagcaaagtatttaaacaaattttctcgaaggtgtgtgtaaat
gaagaaggtattcagaaactacaaagagccatccaggagcatcctgttgttctgctgcct
agtcatcgaagttacattgacttcctcatgttgtcttttcttctatacaattatgatttg
cctgtgccagttatagcagcaggaatggacttcctgggaatgaaaatggttggtgagctg
ctacgaatgtcgggtgcctttttcatgcggcgtacctttggtggcaataaactctactgg
gctgtattctctgaatatgtaaaaactatgttacggaatggttatgctcctgttgaattt
ttcctcgaagggacaagaagccgctctgccaagacattgactcctaaatttggtcttctg
aatattgtgatggagccattttttaaaagagaagtttttgatacctaccttgtcccaatt
agtatcagttatgataagatcttggaagaaactctttatgtgtatgagcttctaggggtt
cctaaaccaaaagagtctacaactgggttgctgaaagccagaaagattctctctgaaaat
tttggaagcatccatgtgtactttggagatcctgtgtcacttcgatctttggcagctggg
aggatgagtcggagctcatataacttggttccaagatacattcctcagaaacagtctgag
gacatgcatgcctttgtcactgaagttgcctacaaaatggagcttctgcaaattgaaaac
atggttttgagcccctggaccctaatagttgctgttctgcttcagaaccggccatccatg
gactttgatgctctggtggaaaagactttatggctaaaaggcttaacccaggcatttgga
gggtttctcatttggcctgataataaacctgctgaagaagttgtcccggccagcattctt
ctgcattccaacattgccagccttgtcaaagaccaggtgattctgaaagtggactccgga
gactcggaagtggtcgatgggcttatgctccagcacatcactctcctcatgtgctcagct
tataggaaccagctgctcaacatttttgtgcgcccatccttagtagcagtagcattgcag
atgacaccagggttcaggaaagaggatgtctacagttgctttcgcttcctacgtgatgtt
tttgcagatgagttcatcttccttccaggaaacacactaaaggactttgaagaaggctgt
tacctgctttgtaaaagtgaagccatacaagtgactacgaaagacatcctagttacagag
aaaggaaatactgtgttagaatttttagtaggactctttaaaccttttgtggaaagctat
cagataatttgcaagtaccttttgagtgaagaagaggaccacttcagtgaggaacagtac
ttggctgcagtcagaaaattcacaagtcagcttctcgatcaaggtacctctcaatgttat
gatgtattatcttctgatgtgcagaaaaacgccttagcagcctgtgtgaggctcggagta
gtggagaagaagaagataaataataactgtatatttaatgtgaatgaacctgccacaacc
aaattagaagaaatgcttggttgtaagacaccaataggaaaaccagccactgcaaaactt
taa

DBGET integrated database retrieval system