KEGG   Homo sapiens (human): 84435Help
Entry
84435             CDS       T01001                                 

Gene name
ADGRA1, GPR123
Definition
(RefSeq) adhesion G protein-coupled receptor A1
  KO
K08460  adhesion G protein-coupled receptor A1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    84435 (ADGRA1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    84435 (ADGRA1)
Peptidases and inhibitors [BR:hsa01002]
 Mixed peptidases
  Family P2
   84435 (ADGRA1)
G protein-coupled receptors [BR:hsa04030]
 Adhesion receptor family
  Others
   84435 (ADGRA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 84435
NCBI-ProteinID: NP_001077378
OMIM: 612302
HGNC: 13838
Ensembl: ENSG00000197177
Vega: OTTHUMG00000019304
Pharos: Q86SQ6(Tdark)
UniProt: Q86SQ6
Position
10q26.3
AA seq 560 aa AA seqDB search
MDLKTVLSLPRYPGEFLHPVVYACTAVMLLCLLASFVTYIVHQSAIRISRKGRHTLLNFC
FHAALTFTVFAGGINRTKYPILCQAVGIVLHYSTLSTMLWIGVTARNIYKQVTKKAPLCL
DTDQPPYPRQPLLRFYLVSGGVPFIICGVTAATNIRNYGTEDEDTAYCWMAWEPSLGAFY
GPAAIITLVTCVYFLGTYVQLRRHPGRRYELRTQPEEQRRLATPEGGRGIRPGTPPAHDA
PGASVLQNEHSFQAQLRAAAFTLFLFTATWAFGALAVSQGHFLDMVFSCLYGAFCVTLGL
FVLIHHCAKREDVWQCWWACCPPRKDAHPALDANGAALGRAACLHSPGLGQPRGFAHPPG
PCKMTNLQAAQGHASCLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGR
TKPPYFSRHPAEEPEYAYHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPM
VTQPEGSDGSPALYSCPTQPGREAALGPGHLEMLRRTQSLPFGGPSQNGLPKGKLLEGLP
FGTDGTGNIRTGPWKNETTV
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggatctgaagacagtgctctccctgccccgctacccaggggagttcctgcaccccgtg
gtgtacgcgtgcacggccgtcatgctgctctgcctcctggcctccttcgtcacctacatc
gtgcaccagagcgccatccgcatcagccgcaagggccggcacacgctcctgaatttctgc
ttccacgcggccctgaccttcactgtgttcgccggcggcatcaatcgcaccaagtacccc
atcctgtgccaggcggtgggcatcgtgctgcactattctacactgtccaccatgctgtgg
ataggagtgaccgccaggaacatctacaagcaggtgaccaagaaggcccctctgtgcctg
gacacagaccagccaccgtaccccaggcagcccctgctcaggttttacctcgtcagcgga
ggggtcccctttatcatctgtggggtcacggctgccacgaacatcaggaattacgggaca
gaggacgaggacacggcgtactgctggatggcctgggagcccagcctgggcgccttctac
ggcccagccgccatcatcaccctggtcacctgtgtgtacttcctgggcacctacgtgcag
ctgcggcgccacccagggcgcaggtacgagctgcgcacacagcccgaggagcagcggcgg
ctggcgacacccgagggcggccgtgggatccggccaggcaccccacccgcacacgatgcc
cccggcgcctccgtgctgcagaacgagcactcattccaggcacagctgcgcgccgccgcc
ttcacgctgttcctgttcacggccacgtgggccttcggggcgctggcggtgtcacagggc
cacttcctggacatggtcttcagctgcctgtacggcgccttctgcgtgaccctgggactc
ttcgtgctcatccaccactgcgccaagcgtgaggacgtgtggcagtgctggtgggcatgc
tgcccgccccgcaaggacgcccaccccgcacttgacgccaacggggccgcgctgggccgc
gccgcctgcctgcactcgccgggactgggccagccacggggcttcgcgcacccaccgggc
ccctgcaagatgaccaacctgcaggccgcgcagggccacgccagttgcctgtcaccggcc
accccgtgctgcgccaagatgcactgcgagccactgacggcggacgaggcgcacgtgcac
ctgcaggaggagggcgccttcgggcacgacccccacctgcacgggtgccttcagggcaga
actaagccgccctactttagccggcacccagcagaggagcccgagtacgcctaccacatc
ccatccagcctggatggcagcccccgcagctcgcgcacagacagcccccccagctctctg
gatggcccggcggggacacacacgctggcctgctgcacccagggcgaccccttccccatg
gtcacccagcccgagggcagtgatgggagccctgccctctacagctgccccacgcagccg
ggcagggaggcagcgctcgggcccggccacttggagatgctgcggaggacacagtccctg
ccctttggtggccccagccagaacgggctgcccaagggtaaattgctagaaggcctgccg
tttggcaccgacgggaccggcaacatccgaacgggaccctggaaaaacgaaactactgtg
tag

DBGET integrated database retrieval system