KEGG   Homo sapiens (human): 84444Help
Entry
84444             CDS       T01001                                 

Gene name
DOT1L, DOT1, KMT4
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  [histone H3]-lysine79 N-trimethyltransferase [EC:2.1.1.360]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    84444 (DOT1L)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    84444 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84444 (DOT1L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.360  [histone H3]-lysine79 N-trimethyltransferase
     84444 (DOT1L)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     84444 (DOT1L)
   HMT complexes
    Dot1-containing complex
     84444 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 84444
NCBI-ProteinID: NP_115871
OMIM: 607375
HGNC: 24948
Ensembl: ENSG00000104885
Vega: OTTHUMG00000150431
Pharos: Q8TEK3(Tchem)
UniProt: Q8TEK3
Structure
PDB: 

Position
19p13.3
AA seq 1537 aa AA seqDB search
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGP
EGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMNTA
NPERKPKKNQTALDALHAQTVSQTAASSPQDAYRSPHSPFYQLPPSVQRHSPNPLLVAPT
PPALQKLLESFKIQYLQFLAYTKTPQYKASLQELLGQEKEKNAQLLGAAQQLLSHCQAQK
EEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLL
KARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLK
SCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTKFSLPHLSSMSPELSMNGQAAGY
ELCGVLSRPSSKQNTPQYLASPLDQEVVPCTPSHVGRPRLEKLSGLAAPDYTRLSPAKIV
LRRHLSQDHTVPGRPAASELHSRAEHTKENGLPYQSPSVPGSMKLSPQDPRPLSPGALQL
AGEKSSEKGLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRAERARST
PSPVLQPRDPSSTLEKQIGANAHGAGSRSLALAPAGFSYAGSVAISGALAGSPASLTPGA
EPATLDESSSSGSLFATVGSRSSTPQHPLLLAQPRNSLPASPAHQLSSSPRLGGAAQGPL
PEASKGDLPSDSGFSDPESEAKRRIVFTITTGAGSAKQSPSSKHSPLTASARGDCVPSHG
QDSRRRGRRKRASAGTPSLSAGVSPKRRALPSVAGLFTQPSGSPLNLNSMVSNINQPLEI
TAISSPETSLKSSPVPYQDHDQPPVLKKERPLSQTNGAHYSPLTSDEEPGSEDEPSSARI
ERKIATISLESKSPPKTLENGGGLAGRKPAPAGEPVNSSKWKSTFSPISDIGLAKSADSP
LQASSALSQNSLFTFRPALEEPSADAKLAAHPRKGFPGSLSGADGLSPGTNPANGCTFGG
GLAADLSLHSFSDGASLPHKGPEAAGLSSPLSFPSQRGKEGSDANPFLSKRQLDGLAGLK
GEGSRGKEAGEGGLPLCGPTDKTPLLSGKAAKARDREVDLKNGHNLFISAAAVPPGSLLS
GPGLAPAASSAGGAASSAQTHRSFLGPFPPGPQFALGPMSLQANLGSVAGSSVLQSLFSS
VPAAAGLVHVSSAATRLTNSHAMGSFSGVAGGTVGGN
NT seq 4614 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagctggagctgagactgaagtcgcccgtgggggctgagcccgccgtctac
ccgtggccgctgccggtctacgataaacatcacgatgctgctcatgaaatcatcgagacc
atccgatgggtctgtgaagaaatcccggatctcaagctcgctatggagaattacgtttta
attgactatgacaccaaaagcttcgagagcatgcagaggctctgcgacaagtacaaccgt
gccatcgacagcatccaccagctgtggaagggcaccacgcagcccatgaagctgaacacg
cggccgtccactggactcctgcgccatatcctgcagcaggtctacaaccactcggtgacc
gaccccgagaagctcaacaactacgagcccttctcccccgaggtgtacggggagacctcc
ttcgacctggtggcccagatgattgatgagatcaagatgaccgacgacgacctgtttgtg
gacttggggagcggtgtgggccaggtcgtgctccaggttgctgctgccaccaactgcaaa
catcactatggcgtcgagaaagcagacatcccggccaagtatgcggagaccatggaccgc
gagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacattggagaga
ggcgatttcctctcagaagagtggagggagcgaatcgccaacacgagtgttatatttgtg
aataattttgcctttggtcctgaggtggatcaccagctgaaggagcggtttgcaaacatg
aaggaaggtggcagaatcgtgtcctcgaaaccctttgcacctctgaacttcagaataaac
agtagaaacttgagtgacatcggcaccatcatgcgcgtggtggagctctcgcccctgaag
ggctcggtgtcgtggacggggaagccagtctcctactacctgcacactatcgaccgcacc
atacttgaaaactatttttctagtctgaaaaacccaaaactcagggaggaacaggaggca
gcccggcgccgccagcagcgcgagagcaagagcaacgcggccacgcccactaagggccca
gagggcaaggtggccggccccgccgacgcccccatggactctggtgctgaggaagagaag
gcgggagcagccaccgtgaagaagccgtctccctccaaagcccgcaagaagaagctaaac
aagaaggggaggaagatggctggccgcaagcgcgggcgccccaagaagatgaacactgcg
aaccccgagcggaagcccaagaagaaccaaactgcactggatgccctgcacgctcagacc
gtgtctcagacggcggcctcctcaccccaggatgcctacagatcccctcacagcccgttc
taccagctacctccgagcgtgcagcggcactcccccaacccgctgctggtggcgcccacc
ccgcccgcgctgcagaagcttctagagtccttcaagatccagtacctgcagttcctggca
tacacaaagaccccccagtacaaggccagcctgcaggagctgctgggccaggagaaggag
aagaacgcccagctcctgggtgcggctcagcagctcctcagccactgccaggcccagaag
gaggagatcaggaggctgtttcagcaaaaattggatgagctgggtgtgaaggcgctgacc
tacaacgacctgattcaagcgcagaaggagatctccgcccataaccagcagctgcgggag
cagtcggagcagctggagcaggacaaccgcgcgctccgcggccagagcttgcagctgctc
aaggctcgctgcgaggagctgcagctggactgggccacgctgtcgctggagaagctgttg
aaggagaagcaggccctgaagagccagatctcggagaagcagaggcactgcctggagctg
cagatcagcattgtggagctagagaagagccagcggcagcaggagctcctgcagctcaag
tcctgtgtgccgcctgacgacgccctgtccctgcacctgcgtgggaagggcgccctgggc
cgcgagctggagcctgacgccagccggctgcacctggagctggactgcaccaagttctcg
ctgcctcacttgagcagcatgagcccggagctctccatgaacggccaggctgctggctat
gagctctgcggtgtgctgagccggccttcgtcgaagcagaacacgccccagtacctggcc
tcacccctggaccaggaggtggtgccctgtacccctagccacgtcggccggccgcgcctg
gagaagctgtctggcctagccgcacccgactacactaggctgtccccggccaagattgtg
ctgaggcggcacctgagccaggaccacacggtgcccggcaggccggctgccagtgagctg
cattcgagagctgagcacaccaaggagaacggccttccctaccagagccccagcgtgcct
ggcagcatgaagctgagccctcaggacccgcggcccctgtcccctggggccttgcagctt
gctggagagaagagcagtgagaagggcctgagagagcgcgcctacggcagcagcggggag
ctcatcaccagcctgcccatcagcatcccgctcagcaccgtgcagcccaacaagctcccg
gtcagcattcccctggccagcgtggtgctgcccagccgcgccgagagggcgaggagcacc
cccagtcccgtgctgcagccccgtgacccctcgtccacacttgaaaagcagattggtgct
aatgcccacggtgctgggagcagaagccttgccctggcccccgcaggcttctcctacgct
ggctcggtggccatcagcggggccttggcgggcagcccggcctctctcacacctggagcc
gagccggccaccttggatgagtcctccagctctgggagcctttttgccaccgtggggtcc
cgcagctccacgccacagcaccccctgctgctggcacagccccggaactcgcttcctgcc
tctcccgcccaccagctctcctccagtccccggcttggtggggccgcccagggcccgttg
cccgaggccagcaagggagacctgccctccgattccggcttctcagatcctgagagtgaa
gccaagaggaggattgtgttcaccatcaccactggtgcgggcagtgccaagcagtcgccc
tccagcaagcacagccccctgaccgccagcgcccgtggggactgtgtgccgagccacggg
caggacagtcgcaggcgcggccggcggaagcgagcatctgcggggacgcccagcttgagc
gcaggcgtgtcccccaagcgccgagccctgccgtccgtcgctggccttttcacacagcct
tcggggtctcccctcaacctcaactccatggtcagtaacatcaaccagcccctggagatt
acagccatctcgtccccggagacctccctgaagagctcccctgtgccctaccaggaccac
gaccagccccccgtgctcaagaaggagcggcctctgagccagaccaatggggcacactac
tccccactcacctcagacgaggagccaggctctgaggacgagcccagcagtgctcgaatt
gagagaaaaattgcaacaatctccttagaaagcaaatctcccccgaaaaccttggaaaat
ggtggtggcttggcgggaaggaagcccgcgcccgccggcgagccagtcaatagcagcaag
tggaagtccaccttctcgcccatctccgacatcggcctggccaagtcggcggacagcccg
ctgcaggccagctccgccctcagccagaactccctgttcacgttccggcccgccctggag
gagccctctgccgatgccaagctggccgctcaccccaggaaaggctttcccggctccctg
tcgggggctgacggactcagcccgggcaccaaccctgccaacggctgcaccttcggcggg
ggcctggccgcggacctgagtttacacagcttcagtgatggtgcttctcttccccacaag
ggccccgaggcggccggcctgagctccccgctgagcttcccctcgcagcgcggcaaggag
ggctcggacgccaaccctttcctgagcaagaggcagctggacggcctggctgggctgaag
ggcgagggcagccgcggcaaggaggcaggggagggcggcctaccgctgtgcgggcccacg
gacaagaccccactgctgagcggcaaggccgccaaggcccgggaccgcgaggtcgacctc
aagaatggccacaacctcttcatctctgcggcggccgtgcctcccggaagcctcctcagc
ggccccggcctggccccggcggcgtcctccgcaggcggcgcggcgtcctccgcccagacg
caccggtccttcctgggccccttcccgccgggaccgcagttcgcgctcggccccatgtcc
ctgcaggccaacctcggctccgtggccggctcctccgtgctgcagtcgctgttcagctct
gtgccggccgccgcaggcctggtgcacgtgtcgtccgctgccaccagactgaccaactcg
cacgccatgggcagcttttccggggtggcaggcggcacagttggaggtaactag

DBGET integrated database retrieval system