KEGG   Homo sapiens (human): 84445Help
Entry
84445             CDS       T01001                                 

Gene name
LZTS2, LAPSER1
Definition
(RefSeq) leucine zipper tumor suppressor 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Fez1 DUF4250
Motif
Other DBs
NCBI-GeneID: 84445
NCBI-ProteinID: NP_001305028
OMIM: 610454
HGNC: 29381
Ensembl: ENSG00000107816
Vega: OTTHUMG00000018914
Pharos: Q9BRK4(Tbio)
UniProt: Q9BRK4 B4DP66
Position
10q24.31
AA seq 669 aa AA seqDB search
MAIVQTLPVPLEPAPEAATAPQAPVMGSVSSLISGRPCPGGPAPPRHHGPPGPTFFRQQD
GLLRGGYEAQEPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL
RGPPPKLIPVSGKLEKNMEKILIRPTAFKPVLPKPRGAPSLPSFMGPRATGLSGSQGSLT
QLFGGPASSSSSSSSSSAADKPLAFSGWASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTT
SSPGGHLPSHGSGRGALPGPARGVPTGPSHSDSGRSSSSKSTGSLGGRVAGGLLGSGTRA
SPDSSSCGERSPPPPPPPPSDEALLHCVLEGKLRDREAELQQLRDSLDENEATMCQAYEE
RQRHWQREREALREDCAAQAQRAQRAQQLLQLQVFQLQQEKRQLQDDFAQLLQEREQLER
RCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQLKESQAELVQKGSELVALRVALRE
ARATLRVSEGRARGLQEAARARELELEACSQELQRHRQEAEQLREKAGQLDAEAAGLREP
PVPPATADPFLLAESDEAKVQRAAAGVGGSLRAQVERLRVELQRERRRGEEQRDSFEGER
LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEQAPCIC
LEEITATEI
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggccattgtgcagactctgccagtgccactggagcctgctcctgaagctgccactgcc
ccacaagctccagtcatgggtagtgtgagcagccttatctcaggccggccctgtcccggg
gggccagctcctccccgccaccacggccctcctgggcccaccttcttccgccagcaggat
ggcctgctacggggtggctatgaggcacaggagccgctgtgcccagctgtgccccctagg
aaggctgtccctgtcaccagcttcacctacatcaatgaggacttccggacagagtcaccc
cccagcccaagcagtgatgttgaggatgcccgagagcagcgggcacacaatgcccacctc
cgcggcccaccaccaaagctcatccctgtctctggaaagctggagaagaacatggagaag
atcctgatccgcccaacagccttcaagccagtgctgcccaaacctcgaggggctccgtcc
ctgcctagcttcatgggtcctcgggccaccgggctgtctgggagccagggcagcctgacg
cagctgtttgggggccctgcctcctcctcctcctcttcctcctcctcttcagctgctgac
aaacccctggcatttagtggctgggccagtggctgcccatcagggacgctatccgactct
ggccgaaactcactgtccagcctgcccacctacagcaccggaggtgccgagccaaccacc
agctccccaggcgggcacctgccttcccatggctctgggcgaggggcactgcctgggcca
gcccgaggggtccctactgggccctcccactcagacagtggccggtcctcctccagcaag
agcacaggctccctagggggccgtgtggctggggggcttttgggcagtggtactcgggcc
tcccctgacagcagctcctgtggggagcgctcaccaccacccccgcctccacctccttcg
gatgaggccctgctgcactgtgtcctggaaggaaagctccgagaccgggaggcagagctt
cagcagctgcgggacagtctggacgagaatgaggctaccatgtgccaggcatacgaggag
cggcagcggcactggcagcgagagcgtgaggccctgcgagaggactgtgcggcccaggca
cagcgggcacagcgggcccaacagctgctgcagctgcaggtgttccagctgcagcaggag
aagcggcaattgcaggacgacttcgcacagctgctgcaggagcgcgaacagctggagcgg
cgctgcgccaccttggagcgggagcagcgggagctcgggccgaggcttgaggagaccaag
tgggaggtgtgccagaaatcaggcgagatctccctgctgaagcagcagctgaaagagtct
caggcagagctggtgcagaagggcagcgagctggtggctctgcgggtggcgctgcgggag
gcccgtgctacgctgcgggtcagtgagggccgtgcgcggggtctacaggaggccgcccga
gctcgggagctggagctggaagcctgttcccaggagctgcagcgacaccgccaggaagct
gagcagctgcgggagaaagctgggcagttggatgctgaggcggccggactccgggagccc
cctgtgccacctgccaccgctgacccattcctcctggcagagagtgatgaggccaaagtg
cagcgggcagcagccggggttgggggcagcttgcgggcccaggtggagcgattgcgggtg
gagctgcagcgggagcggcggcggggtgaggagcagcgggacagctttgagggggagcgg
ctggcctggcaggcagagaaggagcaggtgatccgctaccagaagcagctgcagcacaac
tacatccagatgtaccggcgcaaccggcagctagagcaggagctgcagcagctcagcctg
gagctggaggcccgggagctcgctgacctgggcctggccgagcaggccccctgcatctgc
ctggaggagatcactgctactgagatctag

DBGET integrated database retrieval system