KEGG   Homo sapiens (human): 84456Help
Entry
84456             CDS       T01001                                 

Gene name
L3MBTL3, MBT-1, MBT1
Definition
(RefSeq) L3MBTL histone methyl-lysine binding protein 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MBT SAM_1 SAM_2 zf-C2HC Glyco_hydro_2_N SAM_PNT Apelin
Motif
Other DBs
NCBI-GeneID: 84456
NCBI-ProteinID: NP_115814
HGNC: 23035
Ensembl: ENSG00000198945
Vega: OTTHUMG00000015554
Pharos: Q96JM7(Tchem)
UniProt: Q96JM7
Structure
PDB: 

Position
6q23.1
AA seq 780 aa AA seqDB search
MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDENEMENVKKATA
TTTWMVPTAQEAPTSPPSSRPVFPPAYWTSPPGCPTVFSEKTGMPFRLKDPVKVEGLQFC
ENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKKKPKLSLK
ADTKEDGEERDDEMENKQDVRILRGSQRARRKRRGDSAVLKQGLPPKGKKAWCWASYLEE
EKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDG
YSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFE
NQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASS
PHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMK
LEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPL
QPPLSPLELMEASEHGGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDRL
SGEMPPASPSFPRNKRTDANESSSSPEIRDQHADDVKEDFEERTESEMRTSHEARGAREE
PTVQQAQRRSAVFLSFKSPIPCLPLRWEQQSKLLPTVAGIPASKVSKWSTDEVSEFIQSL
PGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNSHNEL
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatctgcctctagcacaagtggtcaagagtttgatgtgttcagtgttatggac
tggaaagatggagtgggcacgttaccaggaagtgacttaaagtttcgggtaaatgagttt
ggagccctggaagttattacagatgagaatgagatggaaaatgttaaaaaagcaactgct
accaccacttggatggtaccaactgctcaagaagccccgacctctcccccgagctccagg
cccgtatttccacctgcctactggacatctccacctggatgtcccacagtcttttcagag
aagactgggatgcctttcaggttgaaggatccagtgaaagtagaagggcttcagttctgt
gagaactgttgtcagtatggcaacgtagatgagtgtctttctggaggaaactattgcagc
cagaattgtgctcggcacatcaaagataaagatcagaaggaagaaagggacgtagaagaa
gacaatgaggaagaagatcctaagtgtagtcggaagaaaaaaccaaaattatctctgaaa
gctgacaccaaggaggatggagaagagagagatgatgaaatggagaacaaacaagatgta
agaatcctgaggggttcgcagagagcacggaggaaaagacgaggggattcggctgtacta
aagcagggtttgcctcctaaaggaaagaaagcgtggtgctgggcatcctacctggaagag
gagaaagcggtggcagtgccggcgaagctgttcaaggagcatcaatcctttccatataac
aaaaatggattcaaagttggcatgaaattagaaggcgtggatcctgagcatcagtctgtg
tactgtgtcctcaccgtcgcggaggtttgtggataccggataaagcttcactttgatggg
tattctgattgctatgacttctgggtgaatgcagacgctctggatatccacccagttggg
tggtgtgagaaaaccggccacaaactccatcctccaaaagggtataaagaagaagaattc
aattggcagacctatcttaagacatgtaaagctcaagctgctcctaagtcattatttgaa
aatcagaatataacagtgatcccatcgggctttcgagttggtatgaagcttgaggcagta
gacaaaaagaatccctcattcatctgtgttgctacggtaacagatatggtggacaatcgt
ttcctggtacattttgacaactgggatgagagctatgactattggtgtgaagcatcaagt
ccacatattcatccagttggttggtgtaaggaacatagaagaacccttattactccacca
ggttatccaaatgtgaaacatttttcttgggataaatacttagaagaaaccaattcttta
cctgctcctgcaagagctttcaaagtgaaacctcctcatggattccagaaaaaaatgaag
cttgaggttgtagacaaaaggaaccctatgtttattagagtagcaactgtggcagacaca
gatgatcaccgggtaaaagttcactttgatggctggaacaattgctatgattactggata
gatgcagattctcctgatattcaccctgtaggctggtgttcaaaaacaggacatcccctt
cagcctcctttgagccccttagaattaatggaagcttcagaacatggtggatgctcaacc
ccgggatgtaaagggattggccatttcaagagagcgagacatctgggccctcacagtgct
gccaactgtccctattcagaaatcaatttgaataaagaccgtatttttccagaccgctta
agtggtgagatgcctccggctagtccgtcatttccaagaaataaaaggacagatgcaaat
gaaagctcttcttcccctgaaatcagagaccagcatgctgatgatgtcaaagaagacttt
gaagagagaacagaaagtgaaatgagaacatcacatgaagccagaggtgcccgggaagaa
cccaccgtccagcaggcacagcgtcggtcagctgtctttctgtcctttaagtccccaatt
ccatgtctgcccttgcgctgggagcagcaaagcaaacttcttccaactgtcgcaggaatc
cctgccagtaaagtttccaaatggagcacagacgaggtgtcagaatttatacagagctta
cctgggtgtgaagaacatggaaaggtatttaaagatgaacaaattgatggagaagcattt
ctacttatgactcaaacagacattgttaaaattatgagcattaaactgggccctgctctc
aaaattttcaattccatcctgatgttcaaagctgcagagaagaattctcacaatgaactt
tga

DBGET integrated database retrieval system