KEGG   Homo sapiens (human): 84456
Entry
84456             CDS       T01001                                 

Gene name
L3MBTL3, MBT-1, MBT1
Definition
(RefSeq) L3MBTL histone methyl-lysine binding protein 3
  KO
K24387  lethal(3)malignant brain tumor-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    84456 (L3MBTL3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    84456 (L3MBTL3)
SSDB
Motif
Pfam: MBT SAM_1 SAM_2 zf-C2HC Glyco_hydro_2_N SAM_PNT Apelin
Other DBs
NCBI-GeneID: 84456
NCBI-ProteinID: NP_115814
OMIM: 618844
HGNC: 23035
Ensembl: ENSG00000198945
Vega: OTTHUMG00000015554
Pharos: Q96JM7(Tchem)
UniProt: Q96JM7
Structure
PDB: 
3UT1 4L59 4FL6 1WJQ 1WJS

Position
6q23.1
AA seq 780 aa
MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDENEMENVKKATA
TTTWMVPTAQEAPTSPPSSRPVFPPAYWTSPPGCPTVFSEKTGMPFRLKDPVKVEGLQFC
ENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKKKPKLSLK
ADTKEDGEERDDEMENKQDVRILRGSQRARRKRRGDSAVLKQGLPPKGKKAWCWASYLEE
EKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDG
YSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFE
NQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASS
PHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMK
LEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPL
QPPLSPLELMEASEHGGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDRL
SGEMPPASPSFPRNKRTDANESSSSPEIRDQHADDVKEDFEERTESEMRTSHEARGAREE
PTVQQAQRRSAVFLSFKSPIPCLPLRWEQQSKLLPTVAGIPASKVSKWSTDEVSEFIQSL
PGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNSHNEL
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgactgaatctgcctctagcacaagtggtcaagagtttgatgtgttcagtgttatggac
tggaaagatggagtgggcacgttaccaggaagtgacttaaagtttcgggtaaatgagttt
ggagccctggaagttattacagatgagaatgagatggaaaatgttaaaaaagcaactgct
accaccacttggatggtaccaactgctcaagaagccccgacctctcccccgagctccagg
cccgtatttccacctgcctactggacatctccacctggatgtcccacagtcttttcagag
aagactgggatgcctttcaggttgaaggatccagtgaaagtagaagggcttcagttctgt
gagaactgttgtcagtatggcaacgtagatgagtgtctttctggaggaaactattgcagc
cagaattgtgctcggcacatcaaagataaagatcagaaggaagaaagggacgtagaagaa
gacaatgaggaagaagatcctaagtgtagtcggaagaaaaaaccaaaattatctctgaaa
gctgacaccaaggaggatggagaagagagagatgatgaaatggagaacaaacaagatgta
agaatcctgaggggttcgcagagagcacggaggaaaagacgaggggattcggctgtacta
aagcagggtttgcctcctaaaggaaagaaagcgtggtgctgggcatcctacctggaagag
gagaaagcggtggcagtgccggcgaagctgttcaaggagcatcaatcctttccatataac
aaaaatggattcaaagttggcatgaaattagaaggcgtggatcctgagcatcagtctgtg
tactgtgtcctcaccgtcgcggaggtttgtggataccggataaagcttcactttgatggg
tattctgattgctatgacttctgggtgaatgcagacgctctggatatccacccagttggg
tggtgtgagaaaaccggccacaaactccatcctccaaaagggtataaagaagaagaattc
aattggcagacctatcttaagacatgtaaagctcaagctgctcctaagtcattatttgaa
aatcagaatataacagtgatcccatcgggctttcgagttggtatgaagcttgaggcagta
gacaaaaagaatccctcattcatctgtgttgctacggtaacagatatggtggacaatcgt
ttcctggtacattttgacaactgggatgagagctatgactattggtgtgaagcatcaagt
ccacatattcatccagttggttggtgtaaggaacatagaagaacccttattactccacca
ggttatccaaatgtgaaacatttttcttgggataaatacttagaagaaaccaattcttta
cctgctcctgcaagagctttcaaagtgaaacctcctcatggattccagaaaaaaatgaag
cttgaggttgtagacaaaaggaaccctatgtttattagagtagcaactgtggcagacaca
gatgatcaccgggtaaaagttcactttgatggctggaacaattgctatgattactggata
gatgcagattctcctgatattcaccctgtaggctggtgttcaaaaacaggacatcccctt
cagcctcctttgagccccttagaattaatggaagcttcagaacatggtggatgctcaacc
ccgggatgtaaagggattggccatttcaagagagcgagacatctgggccctcacagtgct
gccaactgtccctattcagaaatcaatttgaataaagaccgtatttttccagaccgctta
agtggtgagatgcctccggctagtccgtcatttccaagaaataaaaggacagatgcaaat
gaaagctcttcttcccctgaaatcagagaccagcatgctgatgatgtcaaagaagacttt
gaagagagaacagaaagtgaaatgagaacatcacatgaagccagaggtgcccgggaagaa
cccaccgtccagcaggcacagcgtcggtcagctgtctttctgtcctttaagtccccaatt
ccatgtctgcccttgcgctgggagcagcaaagcaaacttcttccaactgtcgcaggaatc
cctgccagtaaagtttccaaatggagcacagacgaggtgtcagaatttatacagagctta
cctgggtgtgaagaacatggaaaggtatttaaagatgaacaaattgatggagaagcattt
ctacttatgactcaaacagacattgttaaaattatgagcattaaactgggccctgctctc
aaaattttcaattccatcctgatgttcaaagctgcagagaagaattctcacaatgaactt
tga

DBGET integrated database retrieval system