KEGG   Homo sapiens (human): 84461
Entry
84461             CDS       T01001                                 
Symbol
NEURL4
Name
(RefSeq) neuralized E3 ubiquitin protein ligase 4
  KO
K16777  neuralized-like protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84461 (NEURL4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    84461 (NEURL4)
SSDB
Motif
Pfam: Neuralized
Other DBs
NCBI-GeneID: 84461
NCBI-ProteinID: NP_115818
OMIM: 615865
HGNC: 34410
Ensembl: ENSG00000215041
UniProt: Q96JN8
Position
17:complement(7315628..7329335)
AA seq 1562 aa
MAAGSGGSGGSGGGPGPGPGGGGGPSGSGSGPGSNGGLGSGGELHPRTGRLVSLSACGRT
ARRQQPGQEFNHGLVLSREPLRDGRVFTVRIDRKVNSWSGSIEIGVTALDPSVLDFPSSA
TGLKGGSWVVSGCSVLRDGRSVLEEYGQDLDQLGEGDRVGVERTVAGELRLWVNGRDCGV
AATGLPPRVWAVVDLYGKCTQITVLPPEPGFSPPTPIPTPPLEPLAPTEDSALAEQGTSA
DEAFMVSPAQARPETFPNSLESHNDFANMELSEVVSNTILSAYNGGLLNVNLSSPPAGEG
LGSSGAATSPILTSNDALLFHEKCGTLIKLSNNNKTAERRRPLDEFNNGVVMTNRPLRDN
EMFEIRIDKLVDKWSGSIEIGVTTHNPNSLEYPATMTNLQSGTIMMSGCGILTNGKGTRR
EYCEFSLDELQEGDHIGLTRKSNSALHFFINGIDQGVATPLTPPVVYGVVDLYGMAVKVT
IVHNNNHSDRLRRNNAILRALSPEGALRRAAPAAQAEPERLLFHPNCGQKAAITHEGRTA
LRPHATDDFNHGVVLSSRALRDGEVFQVRIDKMVDKWAGSIEIGVTTHNPAYLQLPSTMT
NLRSGTWMMTGNGVMHNGTTILDEYGHNLDRLKAGDTVGVVRREDGTLHFFVNGMTQGPA
AWNVPPGVYAVVDLYGQAAQATIVDDVEVAPVPEPLPEGNNQVSPSSPSSGAGGSDLRFH
QLHGSNAVITNGGRTALRHNCRSEFNDAIVISNRALRDGELFEIVIQKMVDRWSGSIEAG
VTAIRPEDLEFPNTMTDIDYDTWMLSGTAIMQDGNTMRNNYGCDLDALGTGARIGMMRTA
KGDLHYFINGQDQGAACSGLPPGKEVYAVVDLYGQCVQVSITNATGPMDNSLATSNTATE
KSFPLHSPVAGVAHRFHSTCGKNVTLEEDGTRAVRAAGYAHGLVFSTKELRAEEVFEVKV
EELDEKWAGSLRLGLTTLAPGEMGPGAGGGGPGLPPSLPELRTKTTWMVSSCEVRRDGQL
QRMNYGRNLERLGVGSRVGVRRGADDTMHILVDGEDMGPAATGIAKNVWAVLDLYGPVRG
VSIVSSTRLEESEGTQPPSPSSDTGSEGEEDDEGEEHGLGGQNEVGIIPTTLEFLENHGK
NILLSNGNRTATRVASYNQGIVVINQPLVPQLLVQVRIDFLNRQWTSSLVLGVITCAPER
LNFPASACALKRAAWLLRGRGVFHNGLKICEKFGPNLDTCPEGTILGLRLDSSGGLHLHV
NGVDQGVAVPDVPQPCHALVDLYGQCEQVTIVNPEPGAASGKSAGTQGDMEKADMVDGIK
ESVCWGPPPAASPLKSCEYHALCSRFQELLLLPEDYFMPPPKRSLCYCESCRKLRGDEAH
RRRGEPPREYALPFGWCRFNLRVNPRLEAGTLTKKWHMAYHGSNVAAVRRVLDRGELGAG
TASILSCRPLKGEPGVGFEEPGENCAPPREEQPPPVLLSPSLQYAGAETLASKVQFRDPK
SQRTHQAQVAFQVCVRPGSYTPGPPSAALGEPPDPHFSPAELEWVTKEKGATLLCALLVR
VE
NT seq 4689 nt   +upstreamnt  +downstreamnt
atggcggcagggtcgggtgggagtgggggctctgggggaggccctggaccggggccgggc
gggggtgggggccccagcgggagcggctcaggaccggggtccaacgggggtctgggcagc
ggcggggaactgcacccgcgcactgggcgcttggtgagcctgtcggcctgtgggcgtacg
gcgcggcggcagcagccgggccaggagtttaaccacgggctggtgttgagccgagaaccc
ttgcgcgatggacgcgtcttcaccgtccgcatcgaccgcaaggtcaactcctggagcggc
tccattgagattggggtgacagcgctggaccccagtgtgctggactttccaagcagtgcc
acgggcctgaaggggggctcgtgggtagtgtcgggctgctctgtgctgagagatggacgc
tctgtgttggaggagtatggtcaggacctggaccagcttggtgaaggggaccgcgtgggc
gtggagcgcacagttgctggggagcttcggctctgggtgaatgggcgggattgcggtgtg
gctgccacaggcctgccccctcgtgtctgggccgtcgtggacctttatggcaagtgcacc
cagatcaccgtgctaccccctgagccaggcttcagcccccctactcccatccccacacct
cccctcgagcccttggcccccactgaagactctgccttggctgaacaggggacctctgca
gatgaagccttcatggtgtccccagcgcaggcccggccggagacgtttcctaacagcctt
gagtcgcataatgactttgccaacatggagctgtctgaggtggtgagcaacaccatcctg
tctgcctacaatggagggctcctgaatgtgaacctgagctccccaccggcaggggaaggc
ctgggatctagcggtgctgccacctcgcccattctcacttccaacgatgccctgctcttt
catgaaaagtgcgggaccctcatcaaactcagcaacaataataagacggctgagcgccgg
cggcccctggatgaattcaacaatggggttgtcatgaccaatcgcccccttcgggacaat
gagatgtttgagatccgtatcgacaagcttgttgataagtggtcaggctccattgagatt
ggggtcaccacccacaaccccaacagtttggagtacccagccaccatgaccaacctccag
tcaggcaccatcatgatgagcggctgtggaatcctgaccaatggcaagggcacccgccgg
gagtactgcgaattcagtctggatgagttgcaggagggtgaccacattggcctcacaagg
aagtccaactctgccctacacttcttcattaatggtatcgatcagggagtggcaaccccc
ttgacgcccccagtggtgtatggtgtggtggacttgtacgggatggcagtgaaggtgacc
atcgtccacaataacaaccacagtgaccgtctccgccgaaacaacgccatcctgcgggcg
ctgtcccccgagggtgctctccgccgtgctgcccctgccgcccaggcagaacctgagcgc
ctgctcttccaccccaactgtgggcagaaggcagccatcacccacgagggacgcactgcc
ctgaggccccatgccaccgatgacttcaatcacggcgtggtgctgagcagcagagccctg
cgggatggagaggtgttccaggtgcgcatcgacaagatggtggacaaatgggctggctcc
attgaaattggtgtcaccacccacaaccctgcctacctccagttgccctccaccatgacc
aacttgcgctctgggacctggatgatgactgggaatggggtgatgcacaatgggacgacc
atcctggatgaatacgggcacaatctggaccgcctcaaggcaggggacacggtgggcgtg
gtacggcgggaggacgggactctccacttctttgtcaatgggatgactcagggccctgct
gcctggaacgtgcccccgggcgtctatgctgtcgtcgatctctatggccaggcggcccag
gccaccattgtggacgacgtggaggtggctccagttcctgaaccactccctgaggggaac
aaccaggtgtctccaagctctccgtcctcaggggccgggggctctgacctgcgcttccat
cagctgcacggcagtaacgcagtcatcactaacgggggccgcaccgccctccgccacaac
tgtcgcagcgagtttaatgacgccatcgtcatctccaaccgggccctgcgggatggagag
ctgtttgaaattgtcattcagaagatggtggaccgctggtcaggctccattgaggctgga
gtgactgctattcggcctgaagacctggaattccccaacaccatgacagacattgactat
gacacatggatgctgagtggtacagccatcatgcaagacggtaacacgatgcgcaacaat
tatgggtgtgacctggatgcgctgggcacaggtgcacgcattggcatgatgcgaactgcc
aagggcgacctgcactacttcatcaacggccaggaccaaggcgctgcctgctcgggcctg
cctccgggtaaagaggtgtatgcggtagtcgatctctatggccagtgtgtccaagtgtcc
atcaccaatgccaccggccccatggacaacagcctggcgaccagcaacactgccaccgag
aagtccttcccactgcactccccagtggctggcgtggctcaccgattccacagtacttgc
ggcaagaacgtcactctagaggaggatggcacgagggcagtgcgtgccgctggctatgct
catggccttgtcttcagtaccaaggagctgagggctgaggaagtctttgaggtgaaagtg
gaagagctagatgagaagtgggcaggttccctgcggctggggctgaccacactagcaccg
ggggagatgggacccggggcaggcggtggtggcccagggctgcctccttccctgccagag
ctccggacgaagaccacttggatggtatccagctgtgaagtgaggcgtgatgggcagctc
cagaggatgaactatggccggaacctagagaggctgggggtggggagccgtgtgggtgtt
cgtcggggggcagatgacacgatgcacatcctggtggatggagaggatatggggcctgca
gccactggcattgccaagaacgtgtgggctgtgttggatctctacgggccagtccgcggt
gtgtcaattgtcagttccacgagactggaggagtcagaaggcacccagcctccttccccc
agttcagacaccggcagtgagggcgaggaggatgacgagggcgaggagcatggcctggga
ggccagaatgaagtgggtattatacccaccaccctcgagttcctggagaaccatgggaag
aatatccttttgtctaatgggaaccgtacggccacacgggtggccagctacaatcagggc
atcgttgtcatcaaccaacctctggtgccccagctgctggtgcaggtgcggatagatttc
ctaaaccgacagtggacatcttcccttgtcctgggagtcatcacctgcgcgcctgagagg
ctcaacttccctgcttctgcctgtgccctcaaacgggcagcctggctgctgcggggccgt
ggggtcttccacaacggtctcaagatctgcgagaagtttgggcccaatctggacacgtgc
cctgaaggcaccatcctgggactgcggctggacagctctggggggctgcatcttcatgtt
aatggggtggaccagggggtagctgtgccagatgtgccccagccctgccatgcgcttgtg
gacctctatgggcagtgtgagcaggtgacaatcgtgaaccctgagccaggggctgccagt
gggaaaagtgctggaacccaaggggacatggagaaagcagacatggtggacggtatcaaa
gagagtgtgtgctggggtccaccacctgccgctagtcctctaaagagctgcgagtaccat
gccctttgctctcgcttccaagaactcctgctgcttcccgaagattatttcatgcctccg
ccaaagcgaagcctgtgctactgtgagtcttgccggaagctgcgaggagacgaggcccac
aggcgcagaggggagcctccccgggaatatgcactgccctttggctggtgcaggttcaac
ctcagagtgaatccccgcctggaggctgggacactaaccaagaagtggcacatggcatat
cacgggagcaatgttgccgctgtacggagagtgctggaccgaggggagctgggagcaggt
actgcctccatcctgagctgccgtcctttgaagggagaacctggggtagggttcgaggag
cctggcgagaactgtgcacctcctcgggaggagcagccccctcctgtgctgctttccccc
tcccttcaatatgctggggcggagaccctggcctccaaagtgcaattccgggaccccaaa
tcccagcggacgcaccaggctcaggtggcgttccaggtgtgtgtgcgccctggctcctac
accccgggacccccttccgctgcccttggagaacctcctgaccctcacttcagtccagcc
gaacttgagtgggtcactaaggagaagggggccacactcctctgtgccctgctggtacgg
gtggaatga

DBGET integrated database retrieval system