KEGG   Homo sapiens (human): 84466Help
Entry
84466             CDS       T01001                                 

Gene name
MEGF10, EMARDD
Definition
(RefSeq) multiple EGF like domains 10
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF hEGF EGF_2 EGF Syndecan Baculo_11_kDa
Motif
Other DBs
NCBI-GeneID: 84466
NCBI-ProteinID: NP_001243474
OMIM: 612453
HGNC: 29634
Ensembl: ENSG00000145794
Vega: OTTHUMG00000128984
Pharos: Q96KG7(Tbio)
UniProt: Q96KG7
Position
5q23.2
AA seq 1140 aa AA seqDB search
MVISLNSCLSFICLLLCHWIGTASPLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSC
TDILNWFKCTRHRVSYRTAYRHGEKTMYRRKSQCCPGFYESGEMCVPHCADKCVHGRCIA
PNTCQCEPGWGGTNCSSACDGDHWGPHCTSRCQCKNGALCNPITGACHCAAGFRGWRCED
RCEQGTYGNDCHQRCQCQNGATCDHVTGECRCPPGYTGAFCEDLCPPGKHGPQCEQRCPC
QNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQECQCHNGGTCDAATGQCHCSP
GYTGERCQDECPVGTYGVLCAETCQCVNGGKCYHVSGACLCEAGFAGERCEARLCPEGLY
GIKCDKRCPCHLENTHSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGAD
CDSVTGKCTCAPGFKGIDCSTPCPLGTYGINCSSRCGCKNDAVCSPVDGSCTCKAGWHGV
DCSIRCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGEKCELPCQDGTYGLNCAE
RCDCSHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGIC
ECAPGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVC
PSGRFGKNCAGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHN
GAFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHISGQCTCRTGF
MGRHCEQKCPSGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLN
SLSRTSTALPADSYQIGAIAGIIILVLVVLFLLALFIIYRHKQKGKESSMPAVTYTPAMR
VVNADYTISGTLPHSNGGNANSHYFTNPSYHTLTQCATSPHVNNRDRMTVTKSKNNQLFV
NLKNVNPGKRGPVGDCTGTLPADWKHGGYLNELGAFGLDRSYMGKSLKDLGKNSEYNSSN
CSLSSSENPYATIKDPPVLIPKSSECGYVEMKSPARRDSPYAEINNSTSANRNVYEVEPT
VSVVQGVFSNNGRLSQDPYDLPKNSHIPCHYDLLPVRDSSSSPKQEDSGGSSSNSSSSSE
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atggttatttctttgaactcatgcctgagctttatttgtttattgttatgccactggatt
gggacagcatcacctctgaatcttgaagaccctaatgtgtgtagccactgggaaagctac
tcagtgactgtgcaagagtcatacccacatccctttgatcaaatttactacacgagctgc
actgacattctaaactggtttaaatgcacgcggcacagagtcagctatcggacagcctat
cgacatggggagaagactatgtataggcgcaagtctcagtgttgtcctggattttatgaa
agcggggaaatgtgtgtcccccactgtgctgataaatgtgtccatggtcgctgtattgct
ccaaacacctgtcagtgtgagcctggctggggagggaccaactgctccagtgcctgcgat
ggtgatcactggggtccccactgcaccagccggtgccagtgcaaaaatggggctctgtgc
aaccccatcaccggggcttgccactgtgctgcgggcttccggggctggcgctgcgaggac
cgctgtgagcagggcacctatggtaacgactgtcatcagagatgccagtgccagaatgga
gccacctgcgaccacgtcacgggggaatgccgctgcccaccaggatacaccggagccttc
tgtgaggatctttgtcctcctggtaaacatggtccacagtgtgagcagagatgcccttgt
caaaatggaggagtgtgtcatcacgtcactggagaatgctcttgcccttctggctggatg
ggcacagtgtgtggtcagccttgccccgagggtcgctttggaaagaactgttcccaagaa
tgccagtgccataatggagggacgtgtgatgctgccacaggccaatgtcattgcagtcca
ggatacacaggggaacggtgccaggatgagtgtcctgttgggacctatggcgttctctgt
gctgagacctgccagtgtgtcaacggagggaagtgttaccacgtgagcggcgcatgcctc
tgtgaagcaggctttgctggcgagcgctgcgaagcacgcctgtgtcctgaggggctctac
ggcatcaaatgtgacaaacggtgtccctgccacctggaaaacactcatagctgtcacccc
atgtctggagagtgtgcctgcaagccgggctggtcaggactctactgtaatgagacatgt
tctcctggattctacggggaagcttgccagcagatctgcagctgccaaaatggggcagac
tgtgacagtgtgactggaaagtgcacctgtgccccaggattcaaaggaattgactgctct
accccatgccctctgggaacctatgggataaactgttcctctcgctgtggctgtaaaaat
gatgcagtctgctctcctgtggacgggtcttgtacttgcaaggcaggctggcacggggtg
gactgctccatcagatgtcccagtggcacatggggctttggctgtaacttaacatgccag
tgcctcaacgggggagcctgcaacaccctggacgggacctgcacgtgtgcacctggatgg
cgcggggagaaatgcgaacttccctgccaggatggcacgtacgggctgaactgtgctgag
cgctgcgactgcagccacgcagatggctgccaccctaccacgggccattgccgctgcctc
cccggatggtcaggtgtccactgtgacagcgtgtgtgctgagggacgctggggccccaac
tgctccctgccctgctactgtaaaaatggggcttcatgctcccctgatgatggcatctgc
gagtgtgcaccaggcttccgaggcaccacttgtcagaggatctgctcccctggtttttat
gggcatcgctgcagccagacatgcccacagtgcgttcacagcagcgggccctgccaccac
atcaccggcctgtgtgactgcttgcctggcttcacaggcgccctctgcaatgaagtgtgt
cccagtggcagatttgggaaaaactgtgcaggaatttgtacctgcaccaacaacggaacc
tgtaaccccattgacagatcttgtcagtgttaccccggttggattggcagtgactgctct
caaccatgtccacctgcccactggggcccaaactgcatccacacgtgcaactgccataat
ggagctttctgcagcgcctacgatggggaatgtaaatgcactcctggctggacagggctc
tactgcactcagagatgtcctctagggttttatggaaaagattgtgcactgatatgccaa
tgtcaaaacggagctgactgcgaccacatttctgggcagtgtacttgccgcactggattc
atgggacggcactgtgagcagaagtgcccttcaggaacatatggctatggctgtcgccag
atatgtgattgtctgaacaactccacctgcgaccacatcactgggacctgttactgcagc
cccggatggaagggagcgagatgtgatcaagctggtgttatcatagttggaaatctgaac
agcttaagccgaaccagtactgctctccctgctgattcctaccagatcggggccattgca
ggcatcatcattcttgtcctagttgttctcttcctactggcattgttcattatttataga
cacaagcagaagggaaaggaatcaagcatgccagcagttacctacacccctgctatgagg
gtcgtcaatgcagattataccatttcaggaacccttcctcacagcaatggtggaaacgct
aatagccactacttcaccaatcccagttaccacacgctcacccagtgtgccacatcccct
cacgtcaacaacagggacaggatgactgtcacgaagtcaaaaaacaatcaactgtttgtg
aatcttaaaaatgtgaaccctgggaagagaggccctgtgggggactgcactgggacattg
ccggctgactggaaacatggcggctacctcaacgagctcggtgcttttggacttgacaga
agctatatgggaaaatccttaaaagacctgggaaagaattctgaatataattcaagtaac
tgctccctaagcagttctgagaacccatatgccactattaaagacccacctgtacttatc
ccgaaaagctcagagtgtggttatgtggagatgaaatcgccggcacgaagagattcccca
tatgcagagatcaataactcaacttcagccaacaggaatgtctatgaagttgaacctaca
gtgagtgttgtccaaggagtattcagcaataatgggcgtctctcccaggatccatatgac
ctcccaaagaacagtcacatcccttgtcattatgacctgctgccagtccgagacagttca
tcctcccctaagcaagaggacagtggtggtagcagcagcaacagcagcagcagcagtgaa
tga

DBGET integrated database retrieval system