KEGG   Homo sapiens (human): 84467
Entry
84467             CDS       T01001                                 

Gene name
FBN3
Definition
(RefSeq) fibrillin 3
  KO
K23342  fibrillin 2/3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    84467 (FBN3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   84467 (FBN3)
SSDB
Motif
Pfam: EGF_CA cEGF TB EGF FXa_inhibition hEGF EGF_3 Fibrillin_U_N EGF_MSP1_1
Other DBs
NCBI-GeneID: 84467
NCBI-ProteinID: NP_001308360
OMIM: 608529
HGNC: 18794
Ensembl: ENSG00000142449
Vega: OTTHUMG00000182462
Pharos: Q75N90(Tbio)
UniProt: Q75N90 A8KAY2
Position
19p13.2
AA seq 2809 aa
MTLEGLYLARGPLARLLLAWSALLCMAGGQGRWDGALEAAGPGRVRRRGSPGILQGPNVC
GSRFHAYCCPGWRTFPGRSQCVVPICRRACGEGFCSQPNLCTCADGTLAPSCGVSRGSGC
SVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCER
DYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNI
HTGACQDVDECQAVPGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLF
GGRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGSNEFQQLCAQRLPLLPGHPGLF
PGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICRHFTNLCL
NGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCHHGDCVNIPGTYHCRCYPGFQA
TPTRQACVDVDECIVSGGLCHLGRCVNTEGSFQCVCNAGFELSPDGKNCVDHNECATSTM
CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCTNTEGSFRCQCLG
GLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPA
KDSAEFQALCSSGLGITTDGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGK
DCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSPCVSGVC
RNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGA
AWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGL
MLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESL
EFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALD
AQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPL
LCRGGTCTNTDGSYKCQCPPGHELTAKGTACEDIDECSLSDGLCPHGQCVNVIGAFQCSC
HAGFQSTPDRQGCVDINECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDEC
EENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKGS
FVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECH
DLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLN
APGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGG
GNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRG
DSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVI
LEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGT
CYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNI
GQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQ
IGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSYRCKCTRGYKLSPG
GACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCGNGT
CKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFEL
TADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLC
LFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCC
CSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVC
VNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGL
MMTCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHA
RGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGRCVNTAGSFRCDCD
EGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCP
LPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLCAHGECINSLGSFRCHCQAGYTPDATA
TTCLDMDECSQVPKPCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFL
CVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLV
SSGHGCEDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECALSPPTCG
SASCRNTLGGFRCVCPSGFDFDQALGGCQEVDECAGRRGPCSYSCANTPGGFLCGCPQGY
FRAGQGHCVSGLGFSPGPQDTPDKEELLSSEACYECKINGLSPRDRPRRSAHRDHQVNLA
TLDSEALLTLGLNLSHLGRAERILELRPALEGLEGRIRYVIVRGNEQGFFRMHHLRGVSS
LQLGRRRPGPGTYRLEVVSHMAGPWGVQPEGQPGPWGQALRLKVQLQLL
NT seq 8430 nt   +upstreamnt  +downstreamnt
atgactctggagggtctgtatttggcaaggggccccctggcccggctcctgctggcctgg
tcggccctgttgtgcatggcaggtggccaaggccgctgggacggggccttggaggctgca
ggtcctggacgtgtgcggaggcggggcagcccaggcatcttgcaggggccgaatgtgtgc
ggctcccggttccatgcctactgctgtccaggctggaggacattccctggcaggagccag
tgtgtcgtacccatctgtaggcgcgcctgcggtgaaggcttctgctcccagcccaacctg
tgcacctgtgcggatgggacgctggctcccagctgcggggtgagccgagggtcagggtgc
agtgtgagctgtatgaatgggggcacctgccggggggcgtcctgtctgtgtcagaagggc
tacacaggcaccgtgtgtgggcagcccatctgtgaccgcggctgccacaatgggggtcgc
tgcattgggcccaaccgctgcgcctgtgtgtatggcttcatgggacctcaatgtgagaga
gattaccggacgggaccctgctttggccaagtaggccccgaggggtgccagcatcagctg
acgggcctcgtgtgcaccaaggcactttgctgtgccactgtgggccgtgcctggggcctt
ccatgtgaactttgccctgcacagccacacccctgccgccgcggcttcatccccaatatc
cacacgggggcctgccaagatgtggatgagtgccaggctgtgccaggcctgtgccaggga
ggcagctgcgtcaacatggtgggctccttccattgccgctgtccagttggacaccggctc
agtgacagcagcgccgcatgtgaagactaccgggccggcgcctgcttctcagtgcttttc
gggggccgctgtgctggagacctcgccggccactacactcgcaggcagtgctgctgtgac
aggggcaggtgctgggcagctggcccggtccctgagctgtgtcctcctcggggctccaat
gaattccagcaactgtgcgcccagcggctgccgctgctacccggccaccctggcctcttc
cctggcctcctgggcttcggatccaatggcatgggtccccctcttgggccagcgcgactc
aacccccatggctctgatgcgcgtgggatccccagcctgggccctggcaactctaatatt
ggcactgctaccctgaaccagaccattgacatctgccgacacttcaccaacctgtgtctg
aatggccgctgcctgcccacgccttccagctaccgctgcgagtgtaacgtgggctacacc
caggacgtgcgcggcgagtgcattgatgtagacgaatgcaccagcagcccctgccaccac
ggtgactgcgtcaacatccccggcacctaccactgccggtgctacccgggcttccaggcc
acgcccaccaggcaggcatgcgtggatgtggacgagtgcattgtcagtggtggcctttgt
cacctgggccgctgtgtcaacacagagggcagcttccagtgtgtctgcaatgcaggcttc
gagctcagccctgacggcaagaactgtgtggaccacaacgagtgtgccaccagcaccatg
tgcgtcaacggcgtgtgtctcaacgaggatggcagcttctcctgcctctgcaaacccggc
ttcctgctggcgcctggcggccactactgcatggacattgacgagtgccagacgcccggc
atctgcgtgaacggccactgtaccaacaccgagggctccttccgctgccagtgcctgggg
gggctggcggtaggcacggatggccgcgtgtgcgtggacacccacgtgcgcagcacctgc
tatggggccatcgagaagggctcctgtgcccgccccttccctggcactgtcaccaagtcc
gagtgctgctgtgccaatccggaccacggttttggggagccctgccagctttgtcctgcc
aaagactccgctgagttccaggcactgtgcagcagtgggcttggcattaccacggatggt
cgagacatcaacgagtgtgctctggatcctgaggtttgtgccaatggcgtgtgcgagaac
cttcggggcagctaccgctgtgtctgcaacctgggttatgaggcaggtgcctcaggcaag
gactgcacagacgtggatgagtgtgccctcaacagcctcctgtgtgacaacgggtggtgc
cagaatagccctggcagctacagctgctcctgcccccccggcttccacttctggcaggac
acggagatctgcaaagatgtcgacgaatgcctgtccagcccgtgtgtgagtggcgtctgt
cggaacctggccggctcctacacctgcaaatgtggccctggcagccggctggacccctct
ggtaccttctgtctagacagcaccaagggcacctgctggctgaagatccaggagagccgc
tgtgaggtgaaccttcagggagccagcctgcggtctgagtgctgcgccaccctcggggca
gcctgggggagcccctgcgaacgctgcgagatcgaccctgcctgtgcccggggctttgcc
cggatgacgggtgtcacctgcgatgatgtgaacgagtgtgagtccttcccgggagtctgt
cccaacgggcgttgcgtcaacactgctgggtctttccgctgtgagtgtccagagggcctg
atgctggacgcctcaggccggctgtgcgtggatgtgagattggaaccatgtttcctgcga
tgggatgaggatgagtgtggggtcaccctgcctggcaagtaccggatggacgtctgctgc
tgctccatcggggccgtgtggggagtcgagtgcgaggcctgcccggatcccgagtctctg
gagttcgccagcctgtgcccgcgggggctgggcttcgccagccgggacttcctgtctggc
cgaccattctataaagatgtgaatgaatgcaaggtgttccctggcctctgcacgcacggt
acctgcagaaacacggtgggcagcttccactgcgcctgtgcggggggcttcgccctggat
gcccaggaacggaactgcacagatatcgacgagtgtcgcatctctcctgacctctgcggc
cagggcacctgtgtcaacacgccgggcagctttgagtgcgagtgttttcccggctacgag
agtggcttcatgctgatgaagaactgcatggacgtggacgagtgtgcaagggacccgctg
ctctgccggggaggcacttgcaccaacacggatgggagctacaagtgccagtgtccccct
gggcatgagctgacggccaagggcactgcctgtgaggacatcgatgagtgctccctgagt
gatggcctgtgtccccatggccagtgtgtcaatgtcatcggtgccttccagtgctcctgc
catgccggcttccagagcacacctgaccgccagggctgcgtggacatcaacgaatgccgg
gtccagaatggtgggtgtgacgtgcactgtattaacactgagggcagctaccggtgcagc
tgtgggcagggctactcgctgatgcccgacggaagggcatgtgcagacgtggacgagtgt
gaagagaacccccgcgtttgtgaccaaggccactgcaccaacatgccagggggtcaccgc
tgcctgtgctatgatggcttcatggccacgccagacatgaggacatgtgttgatgtggat
gagtgtgacctgaaccctcacatctgcctccatggggactgcgagaacacgaagggttcc
tttgtctgccactgtcagctgggctacatggtcaggaagggggccacaggctgctctgat
gtggatgaatgcgaggttggaggacacaactgtgacagtcacgcctcctgtctcaacatc
ccggggagtttcagctgtaggtgcctgccaggctgggtgggggatggcttcgaatgtcac
gacctggatgaatgcgtctcccaggagcaccggtgcagcccaagaggtgactgtctcaat
gtccctggctcctaccgctgcacctgccgccagggctttgccggggatggcttcttctgc
gaagacagggatgaatgtgccgagaacgtggacctctgtgacaacgggcagtgcctcaat
gcgcccggcgggtaccgctgtgaatgtgagatgggctttgaccccaccgaggaccaccgg
gcctgccaggatgtggacgagtgtgcgcaagggaacctctgtgcatttgggagctgtgag
aacctgcctggaatgttccgctgcatctgcaatggtggctacgaactggaccgagggggt
ggcaactgcacagacatcaacgagtgtgcagacccagtaaactgcatcaacggcgtgtgc
attaacacccccggcagctacctctgcagctgcccccaggattttgagctgaaccccagc
ggagtgggctgcgtggacactcgggccgggaactgtttcctggagacgcatgaccgaggg
gacagtggcatttcctgcagtgccgagatcggagttggtgtcacccgagcttcctgctgt
tgctccctgggccgggcttggggcaatccctgtgagctgtgccctatggccaacaccact
gagtacagaaccctgtgcccgggtggtgagggcttccagcctaaccgcatcactgtcatt
ctggaagacatcgacgagtgccaagagctgccagggctgtgtcaggggggtgactgcgtc
aacacgtttggcagtttccagtgtgagtgcccacctggctaccacctcagtgagcacacc
cgcatctgtgaggatattgacgaatgctccacacactccggcatctgtggccctggcacc
tgctacaacaccctggggaactacacctgtgtctgccctgcagagtacctccaagtcaat
ggtggcaacaactgcatggatatgaggaagagtgtctgcttccggcactataacggcaca
tgtcaaaatgagctggccttcaacgtgacccggaaaatgtgttgctgctcctacaacatt
ggccaggcctggaatagaccctgtgaggcctgccccactcccatcagtcctgactaccag
atcctgtgtggaaatcaggccccgggattcctcactgacatccacacggggaagcccctt
gacattgatgagtgtggggagatccccgccatctgtgccaatggcatctgcataaaccag
atcgggagtttccgctgcgagtgccccgcaggcttcaactacaacagcatcctgctggct
tgtgaagatgtcgatgagtgtggcagcagggagagtccctgccagcagaatgctgactgc
atcaacatccccggtagctaccgctgcaagtgcacccgagggtacaaactgtcgccaggc
ggggcttgtgtgggacggaatgagtgtcgggagatcccgaatgtctgtagccatggtgac
tgcatggacacagaaggcagctacatgtgtctgtgtcaccgtggattccaggcctctgca
gaccagaccctgtgcatggacattgacgagtgtgaccggcagccttgtggaaatgggacc
tgcaagaacatcattggctcctacaactgcctctgcttccctggctttgtggtgacacac
aatggggattgtgtggattttgatgagtgtactaccctggtggggcaggtgtgccgattt
ggccattgcctcaacacagctggttccttccactgcctctgccaggatggctttgagctc
acagctgatgggaagaactgtgtggacaccaatgagtgcctcagccttgcaggaacctgc
ctacccggcacttgccagaacctcgagggctccttccgctgcatctgtccccctggcttc
caggtgcagagtgaccactgcattgatatcgacgagtgctcagaggagcccaacctctgc
ctctttggcacctgtaccaacagccctgggagcttccagtgcctctgcccacctggcttt
gtcctctctgacaatgggcaccgttgctttgacacacggcagagtttctgcttcacccgt
tttgaggctgggaagtgctcggtgcccaaagctttcaacaccaccaagacccgctgctgc
tgcagtaagaggcctggggagggctggggagacccctgcgaactgtgtccccaggagggc
agcgctgcctttcaggagctctgcccctttggccacggggcagtcccaggcccggatgac
tcccgagaagacgtgaatgagtgtgcagagaaccctggcgtctgcactaacggcgtctgt
gtcaacaccgatggatccttccgctgtgagtgtccctttggctacagcctggacttcact
ggcatcaactgtgtggacacagacgagtgctctgtcggccacccctgtgggcaagggaca
tgcaccaatgtcatcggaggcttcgaatgtgcctgtgctgacggctttgagcctggcctc
atgatgacctgcgaggacatcgacgaatgctccctgaacccgctgctctgtgccttccgc
tgccacaataccgagggctcctacctgtgcacctgtccagccggctacaccctgcgggag
gatggggccatgtgtcgagatgtggacgagtgtgcagatggtcagcaggactgccacgcc
cggggcatggagtgcaagaacctcatcggtaccttcgcgtgcgtctgtcccccaggcatg
cggcccctgcctggctctggggagggctgcacagatgacaatgaatgccacgctcagcct
gacctctgtgtcaacggccgctgtgtcaacaccgcgggcagcttccggtgcgactgtgat
gagggattccagcccagccccacccttaccgagtgccacgacatccggcaggggccctgc
tttgccgaggtgctgcagaccatgtgccggtctctgtccagcagcagtgaggctgtcacc
agggccgagtgctgctgtgggggtggccggggctgggggccccgctgcgagctctgtccc
ctgcccggcacctctgcctacaggaagctgtgcccccatggctcaggctacactgctgag
ggccgagatgtagatgaatgccgtatgcttgctcacctgtgtgctcatggggagtgcatc
aacagccttggctccttccgctgccactgtcaggccgggtacacaccggatgctactgct
actacctgcctggatatggatgagtgcagccaggtccccaagccatgtaccttcctctgc
aaaaacacgaagggcagtttcctgtgcagctgtccccgaggctacctgctggaggaggat
ggcaggacctgcaaagacctggacgaatgcacctcccggcagcacaactgtcagttcctc
tgtgtcaacactgtgggcgccttcacctgccgctgtccgcccggcttcacccagcaccac
caggcctgcttcgacaatgatgagtgctcagcccagcctggcccatgtggtgcccacggg
cactgccacaacaccccgggcagcttccgctgtgaatgccaccaaggcttcaccctggtc
agctcaggccatggctgtgaagatgtgaatgaatgtgatgggccccaccgctgccagcat
ggctgtcagaaccagctagggggctaccgctgcagctgcccccagggtttcacccagcac
tcccagtgggcccagtgtgtggatgagaatgagtgtgccctgtcgccccccacctgcggg
agcgcctcctgtcgcaacactcttggtggcttccgctgcgtctgcccctctggctttgac
tttgatcaggccctcgggggctgccaggaggtggatgagtgcgccggacggcgtggcccc
tgtagctacagctgtgccaacacgcctggtggcttcctgtgcggctgtcctcaaggctac
ttccgggctgggcaagggcactgtgtctccggcctgggcttcagccccggaccccaggac
accccggacaaagaggagctgctctcgtctgaagcctgctacgaatgcaagatcaatggc
ctctcccctcgggaccggccacgacgcagtgcccacagggaccaccaggtgaacctggcc
acccttgactccgaggccctgctgaccttgggcctgaacctctcacacctgggccgggcc
gagcgcatcctggagctccggccggccctggagggtctagagggccggatccgctacgtc
atcgtccgcggaaacgagcaaggtttctttcgcatgcatcacctccgtggcgtcagctcc
ctgcagctggggcggaggcggccggggcctggaacctaccggctggaggtggtgagccac
atggcaggaccctggggtgtccagccagaggggcagccagggccatggggccaggccttg
aggctgaaggtgcagctgcagttgctttag

DBGET integrated database retrieval system