KEGG   Homo sapiens (human): 84498
Entry
84498             CDS       T01001                                 

Gene name
FAM120B, CCPG, KIAA1838, PGCC1, SAN1, dJ894D12.1
Definition
(RefSeq) family with sequence similarity 120B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: XPG_I_2 DUF4655
Other DBs
NCBI-GeneID: 84498
NCBI-ProteinID: NP_115824
OMIM: 612266
HGNC: 21109
Ensembl: ENSG00000112584
Vega: OTTHUMG00000016080
Pharos: Q96EK7(Tbio)
UniProt: Q96EK7 B4DSS4
Position
6q27
AA seq 910 aa
MGVRGLQGFVGSTCPHICTVVNFKELAEHHRSKYPGCTPTIVVDAMCCLRYWYTPESWIC
GGQWREYFSALRDFVKTFTAAGIKLIFFFDGMVEQDKRDEWVKRRLKNNREISRIFHYIK
SHKEQPGRNMFFIPSGLAVFTRFALKTLGQETLCSLQEADYEVASYGLQHNCLGILGEDT
DYLIYDTCPYFSISELCLESLDTVMLCREKLCESLGLCVADLPLLACLLGNDIIPEGMFE
SFRYKCLSSYTSVKENFDKKGNIILAVSDHISKVLYLYQGEKKLEEILPLGPNKALFYKG
MASYLLPGQKSPWFFQKPKGVITLDKQVISTSSDAESREEVPMCSDAESRQEVPMCTGPE
SRREVPVYTDSEPRQEVPMCSDPEPRQEVPTCTGPESRREVPMCSDPEPRQEVPMCTGPE
ARQEVPMYTDSEPRQEVPMYTDSEPRQEVPMYTGSEPRQEVPMYTGPESRQEVPMYTGPE
SRQEVLIRTDPESRQEIMCTGHESKQEVPICTDPISKQEDSMCTHAEINQKLPVATDFEF
KLEALMCTNPEIKQEDPTNVGPEVKQQVTMVSDTEILKVARTHHVQAESYLVYNIMSSGE
IECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPLRH
PDLVRPLQMTIPGGTPSLKILWLNQEPEIQVRRLDTLLACFNLSSSREELQAVESPFQAL
CCLLIYLFVQVDTLCLEDLHAFIAQALCLQGKSTSQLVNLQPDYINPRAVQLGSLLVRGL
TTLVLVNSACGFPWKTSDFMPWNVFDGKLFHQKYLQSEKGYAVEVLLEQNRSRLTKFHNL
KAVVCKACMKENRRITGRAHWGSHHAGRWGRQGSSYHRTGSGYSRSSQGQPWRDQGPGSR
QYEHDQWRRY
NT seq 2733 nt   +upstreamnt  +downstreamnt
atgggtgtgagaggtttgcaaggatttgtgggaagtacctgcccacatatatgtacagta
gtaaatttcaaagaactggcagagcaccaccgaagcaagtatcctggatgtacccctacc
attgtggttgatgccatgtgttgtctcagatattggtatactccagaatcttggatctgc
ggtggccagtggcgagaatacttttctgctttgcgagattttgttaaaacttttacggca
gctgggatcaagttgatattcttctttgatggcatggtggagcaggataagagagatgaa
tgggtgaaacgaaggctcaagaacaacagggagatatccaggatttttcattacatcaag
tcacacaaggagcagccaggcagaaatatgttcttcatcccctcagggctagctgtgttt
acacgatttgctctaaagacactgggccaggaaactttgtgttctttgcaggaagcagat
tatgaggtagcttcctatggcctccagcataactgtcttgggattctgggggaagacact
gattacctaatctatgacacttgtccctacttttcaattagcgagctctgcctagagagc
ctggacaccgtcatgctctgcagagagaagctctgtgagagtctgggcctctgtgtggcc
gaccttcctcttctggcctgcctccttggcaacgacataatcccagagggcatgtttgaa
agctttaggtacaaatgcttatcgtcctacacctctgtaaaagagaactttgacaaaaaa
ggtaacatcatattagctgtgtcagaccatatatcgaaagttctttacttgtatcaaggt
gagaaaaaattagaagagatattacctctgggaccaaacaaagctcttttttataaagga
atggcatcatatcttttaccaggacaaaaatctccatggtttttccaaaaacccaaaggt
gtaataactttggacaaacaagtaatatccacgagttcagacgccgaatccagggaagaa
gttcccatgtgttcagatgctgaatccaggcaagaagttcccatgtgtacaggccctgaa
tccaggcgagaagttcccgtgtatacagattctgaacccaggcaagaagttcccatgtgt
tcagaccctgaacccaggcaagaagttcccacgtgtacaggccctgaatccaggcgagaa
gttcccatgtgttcagaccctgaacccaggcaagaagttcccatgtgtacaggccctgaa
gccaggcaagaagttcccatgtatacagactctgaacccaggcaagaagttcccatgtat
acagactctgaacccaggcaagaagttcccatgtatacaggctctgaacccaggcaagaa
gttcccatgtatacaggccctgaatccaggcaagaagttcccatgtatacaggccctgaa
tccaggcaagaagttttaatacggacagaccctgaatctaggcaagaaattatgtgtaca
ggccatgaatccaaacaggaagttcccatatgtacagatcctatatccaagcaagaagac
tccatgtgtacacacgctgaaatcaatcaaaaattacctgtagcaacagattttgaattt
aagctagaagctctcatgtgtacaaaccctgaaattaaacaagaagaccccacaaatgtg
gggcctgaagtaaagcaacaagtaaccatggtttcagacactgaaatcttaaaggttgct
agaacacatcacgtccaagcagaaagctacctggtgtacaacatcatgagcagtggagag
attgaatgcagcaacaccctagaagatgagcttgaccaggccttacccagccaggccttc
atttaccgtcccattcgacagcgggtctactcactcttactggaggactgtcaagatgtc
accagcacctgcctagctgtcaaggagtggtttgtgtatcctgggaacccactgaggcac
ccggacctcgtcaggccgctgcagatgaccattccagggggaacgcctagtttgaaaata
ttatggctgaaccaagagccagaaatacaggttcggcgcttggacacactcctagcctgt
ttcaatctttcctcctcaagagaagagctgcaggctgtcgaaagcccatttcaagctttg
tgctgcctcttgatctacctctttgtccaggtggacacgctttgcctggaggatttgcat
gcgtttattgcgcaggccttgtgcctccaaggaaaatccacctcgcagcttgtaaatcta
cagcctgattacatcaaccccagagccgtgcagctgggctcccttctcgtccgcggcctc
accactctggttttagtcaacagcgcatgtggcttcccctggaagacgagtgatttcatg
ccctggaatgtatttgacgggaagctttttcatcagaagtacttgcaatctgaaaagggt
tatgctgtggaggttcttttagaacaaaatagatctcggctcaccaaattccacaacctg
aaggcagtcgtctgcaaggcctgcatgaaggagaacagacgcatcactggccgagcccac
tggggctcacaccacgcagggaggtggggaagacagggctccagctaccacaggacgggc
tctgggtatagccgttccagtcagggacagccgtggagagaccagggaccaggaagcaga
cagtatgagcatgaccagtggagaaggtactag

DBGET integrated database retrieval system